Lus10017489 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39090 314 / 4e-108 EMB3005, RD19A, RD19 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
AT2G21430 305 / 1e-104 Papain family cysteine protease (.1)
AT4G16190 281 / 6e-95 Papain family cysteine protease (.1)
AT3G54940 250 / 8e-83 Papain family cysteine protease (.2)
AT3G19400 107 / 1e-27 Cysteine proteinases superfamily protein (.1.2)
AT5G60360 107 / 1e-27 SAG2, AALP SENESCENCE ASSOCIATED GENE2, aleurain-like protease (.1.2.3)
AT3G19390 107 / 2e-27 Granulin repeat cysteine protease family protein (.1)
AT3G45310 105 / 4e-27 Cysteine proteinases superfamily protein (.1.2)
AT1G06260 104 / 1e-26 Cysteine proteinases superfamily protein (.1)
AT1G20850 102 / 5e-26 XCP2 xylem cysteine peptidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017487 370 / 2e-130 AT4G39090 550 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Lus10028797 370 / 7e-130 AT4G39090 559 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Lus10002103 288 / 4e-99 AT4G39090 431 / 5e-153 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Lus10024303 289 / 6e-98 AT4G39090 520 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Lus10038684 234 / 2e-76 AT3G54940 499 / 1e-177 Papain family cysteine protease (.2)
Lus10037951 206 / 5e-64 AT3G54940 451 / 6e-157 Papain family cysteine protease (.2)
Lus10020734 105 / 4e-27 AT5G45890 390 / 4e-136 senescence-associated gene 12 (.1)
Lus10034895 105 / 6e-27 AT3G45310 524 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Lus10020722 103 / 2e-26 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G160300 336 / 1e-116 AT4G39090 549 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Potri.009G121300 332 / 5e-115 AT4G39090 571 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Potri.002G028700 318 / 1e-109 AT4G39090 536 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Potri.005G234000 313 / 8e-108 AT4G39090 501 / 9e-179 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1)
Potri.010G228400 232 / 1e-75 AT3G54940 501 / 6e-179 Papain family cysteine protease (.2)
Potri.006G141700 106 / 2e-27 AT3G45310 590 / 0.0 Cysteine proteinases superfamily protein (.1.2)
Potri.004G055900 104 / 9e-27 AT5G45890 438 / 5e-155 senescence-associated gene 12 (.1)
Potri.007G047600 101 / 2e-25 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1)
Potri.007G076000 99 / 8e-25 AT5G45890 407 / 2e-142 senescence-associated gene 12 (.1)
Potri.007G075300 99 / 9e-25 AT5G45890 406 / 6e-142 senescence-associated gene 12 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF00112 Peptidase_C1 Papain family cysteine protease
Representative CDS sequence
>Lus10017489 pacid=23163130 polypeptide=Lus10017489 locus=Lus10017489.g ID=Lus10017489.BGIv1.0 annot-version=v1.0
ATGAGGTTTGATCTTCTTATAACCTTCCCTCTTTACATAACTTCAGCAAGAGCTATTATTAACGAATTGGTCGATTACCAGTGTGACCCAGAAGAGAAAG
GAGCATGCGACGCTGGATGTGGAGGAGGCCTAATGAACAGTGCCTTCGAGTACACTCTAAAAGCCGGAGGGCTCATGCGAGAGGAAGACTACCCTTACAC
TGGCACTGACCGCAGCACCTGCAAGTTCGACAAGAGCAAGATCGCAGCCAAAGTAGCAAACTTTAGTGTCATCTCCATTGATGAAGACCAGATTGCTGCT
AACCTCGTCCAGAGTGGCCCTCTCGCTGTGGCGATCAATGCGGTGTACATGCAGACCTACATCGGCGGGGTGTCGTGCCCTTACATCTGCTCGAAGAGGC
TAGACCACGGTGTGCTATTGGTGGGGTATGGGGAGGCAGGGTACGCACCGATCAGGATGAAGGAGAAGCCGTACTGGATCATAAAGAACTCGTGGGGGGA
GACCTGGGGGGAGAGTGGCTACTACAAGATCTGCAGAGGAAAGAACGTCTGCGGAGTTGATTCCATGGTTTCCTCTGTTGCTGCTGTTCAGACCACTGCT
CATTAG
AA sequence
>Lus10017489 pacid=23163130 polypeptide=Lus10017489 locus=Lus10017489.g ID=Lus10017489.BGIv1.0 annot-version=v1.0
MRFDLLITFPLYITSARAIINELVDYQCDPEEKGACDAGCGGGLMNSAFEYTLKAGGLMREEDYPYTGTDRSTCKFDKSKIAAKVANFSVISIDEDQIAA
NLVQSGPLAVAINAVYMQTYIGGVSCPYICSKRLDHGVLLVGYGEAGYAPIRMKEKPYWIIKNSWGETWGESGYYKICRGKNVCGVDSMVSSVAAVQTTA
H

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10017489 0 1
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10017487 1.0 0.9937
AT2G17150 NLP1 Plant regulator RWP-RK family ... Lus10023931 4.0 0.9332
AT3G06240 F-box family protein (.1) Lus10014793 4.9 0.9360
AT5G50760 SAUR-like auxin-responsive pro... Lus10011332 5.5 0.9236
AT5G03380 Heavy metal transport/detoxifi... Lus10023924 6.0 0.9424
AT1G67810 SUFE2 sulfur E2 (.1) Lus10006468 8.2 0.8975
AT1G64300 Protein kinase family protein ... Lus10032357 9.8 0.8895
AT5G43200 Zinc finger, C3HC4 type (RING ... Lus10019685 12.2 0.9026
AT1G76360 Protein kinase superfamily pro... Lus10013223 13.0 0.9108
AT5G41810 unknown protein Lus10001907 13.4 0.9279

Lus10017489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.