Plant FIBer expression Database

Lus10017505 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G78190 175 / 5e-58 Trm112p-like protein (.1)
AT1G22270 146 / 2e-46 Trm112p-like protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032269
[exp]
207 / 1e-70 AT1G78190 186 / 3e-62 Trm112p-like protein (.1)
Lus10024634
[exp]
206 / 2e-70 AT1G78190 187 / 8e-63 Trm112p-like protein (.1)
Lus10028778
[exp]
204 / 4e-62 AT5G45140 1711 / 0.0 nuclear RNA polymerase C2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G165000
[exp]
190 / 9e-64 AT1G22270 165 / 4e-54 Trm112p-like protein (.1)
Potri.002G096600
[exp]
167 / 1e-54 AT1G22270 169 / 2e-55 Trm112p-like protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0167 Zn_Beta_Ribbon PF03966 Trm112p Trm112p-like protein
Representative CDS sequence
>Lus10017505 pacid=23163183 polypeptide=Lus10017505 locus=Lus10017505.g ID=Lus10017505.BGIv1.0 annot-version=v1.0
ATGAGACTGCTCACTCACAACATGCTCTCCTCCAACATCAAGGGAGTCGACAATGGCTTCCCACTGGTTATCCAAGCCCAGAAAGCGATACAAAAGGAAG
CCGATCTCAATCCGGACTTCCTCCGTAACATCTTCCCCAAGATCGAGTGGAGAGCCCTGGTGGACGCCGCCCGTGCCGTCGGATACACGGAGTTGCCGGA
GAAGACGGAGGGTTCGATGTTGGATTCCGATGATTTCTTGGCGAAGTTCCACCACGCGCTACTTGAGATCCACCTCGAGGAAAGCTCGTTGGTCTGCCCA
GAGACCGGCCGGCAGTTCTCCGTCAGTAAAGGGATCCCCAATATGCTTCTCCGCGAAGACGAGGTTTGA
AA sequence
>Lus10017505 pacid=23163183 polypeptide=Lus10017505 locus=Lus10017505.g ID=Lus10017505.BGIv1.0 annot-version=v1.0
MRLLTHNMLSSNIKGVDNGFPLVIQAQKAIQKEADLNPDFLRNIFPKIEWRALVDAARAVGYTELPEKTEGSMLDSDDFLAKFHHALLEIHLEESSLVCP
ETGRQFSVSKGIPNMLLREDEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G78190 Trm112p-like protein (.1) Lus10017505
[exp]
0 1
Lus10000961
[exp]
1.7 0.7842
AT4G01200 Calcium-dependent lipid-bindin... Lus10008731
[exp]
5.8 0.7867
AT2G15910 CSL zinc finger domain-contain... Lus10023841
[exp]
6.7 0.7775
AT1G70280 NHL domain-containing protein ... Lus10012989
[exp]
16.1 0.7593
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Lus10019441
[exp]
16.7 0.7857
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Lus10043297
[exp]
19.7 0.7727
AT1G27970 NTF2B nuclear transport factor 2B (.... Lus10032033
[exp]
22.8 0.7792
AT3G03980 NAD(P)-binding Rossmann-fold s... Lus10002628
[exp]
29.8 0.7515
AT5G43400 Uncharacterised conserved prot... Lus10013399
[exp]
34.3 0.7329
AT5G40370 GRXC2 glutaredoxin C2, Glutaredoxin ... Lus10013089
[exp]
37.1 0.7334

Lus10017505 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.