Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G01490 54 / 6e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT5G52740 46 / 2e-07 Copper transport protein family (.1) AT5G52770 46 / 3e-07 Copper transport protein family (.1) AT5G23760 40 / 4e-05 Copper transport protein family (.1) AT1G63950 39 / 9e-05 Heavy metal transport/detoxification superfamily protein (.1) AT5G52750 39 / 0.0002 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028762 [exp] 176 / 3e-58 AT1G01490 74 / 3e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10014967 [exp] 66 / 4e-14 AT1G01490 100 / 9e-27 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027524 [exp] 64 / 5e-13 AT1G01490 100 / 2e-25 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10039286 [exp] 62 / 2e-12 AT1G01490 97 / 2e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027523 [exp] 58 / 1e-11 AT1G01490 77 / 3e-19 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10027522 [exp] 53 / 9e-10 AT1G01490 83 / 7e-21 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10007911 [exp] 54 / 2e-09 AT1G01490 128 / 2e-37 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10036395 [exp] 52 / 4e-09 AT1G01490 131 / 1e-38 Heavy metal transport/detoxification superfamily protein (.1.2) Lus10024672 [exp] 50 / 1e-08 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G073000 [exp] 107 / 5e-31 AT1G01490 96 / 5e-26 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.001G099500 [exp] 88 / 2e-23 AT1G01490 105 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147200 [exp] 86 / 2e-22 AT1G01490 64 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147000 [exp] 82 / 3e-21 AT1G01490 61 / 2e-12 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.004G073100 [exp] 82 / 4e-21 AT1G01490 82 / 2e-20 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147400 [exp] 76 / 8e-19 AT1G01490 74 / 2e-17 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147500 [exp] 74 / 6e-18 AT1G01490 91 / 4e-24 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.003G132200 [exp] 69 / 7e-16 AT1G01490 102 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.014G089700 [exp] 62 / 7e-13 AT1G01490 115 / 9e-33 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.017G147300 [exp] 57 / 1e-11 AT1G01490 87 / 2e-22 Heavy metal transport/detoxification superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10017520 pacid=23163104 polypeptide=Lus10017520 locus=Lus10017520.g ID=Lus10017520.BGIv1.0 annot-version=v1.0 ATGAAGGCGGTTGCAGCGCTTTCAAGCATCGATTCGATTACAATCGACTTGAAGGATCAGAAGCTGACTGTGATCGGAGATGTGGATCCGATCCACCTCA TGTCGAAGCTGAAGAAGTGCTGCGCCTCCGAGCTCTTGACCGTCGGACCGGCGCCCAAGGCGGATGAGAAGAAAGACGAGAAGAAGAAGGAGGACGAGAA GAAGAAAGAGGATCAAGGGAAGAAAGAAGACGAGAAGAAGAAATCAGATCCGGCTATGGAGCAGCGCCATATTCAGGAGCTTGTGAATTCTTACAGATCG TACAATCCCAACATGACTCAGTATTACCAAGTGGTCAGCGCTGAAGAAAACCCCAACAGTTGCGTCGTTTCCTAA
AA sequence Show only first row Show all	>Lus10017520 pacid=23163104 polypeptide=Lus10017520 locus=Lus10017520.g ID=Lus10017520.BGIv1.0 annot-version=v1.0 MKAVAALSSIDSITIDLKDQKLTVIGDVDPIHLMSKLKKCCASELLTVGPAPKADEKKDEKKKEDEKKKEDQGKKEDEKKKSDPAMEQRHIQELVNSYRS YNPNMTQYYQVVSAEENPNSCVVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G01490			Heavy metal transport/detoxifi...		Lus10017520 [exp]	0	1
AT5G41810			unknown protein		Lus10001907 [exp]	1.0	0.9705
AT1G01490			Heavy metal transport/detoxifi...		Lus10028762 [exp]	3.2	0.9375
AT4G13180			NAD(P)-binding Rossmann-fold s...		Lus10010673 [exp]	3.2	0.9532
AT3G15760			unknown protein		Lus10030098 [exp]	3.9	0.9459
AT5G59590		UGT76E2	UDP-glucosyl transferase 76E2 ...		Lus10016460 [exp]	5.1	0.9260
AT1G16670			Protein kinase superfamily pro...		Lus10026503 [exp]	5.2	0.9415
AT5G67400		RHS19	root hair specific 19 (.1)		Lus10032035 [exp]	6.2	0.9360
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Lus10026041 [exp]	7.7	0.9364
AT3G10915			Reticulon family protein (.1.2...		Lus10034224 [exp]	8.1	0.9440
AT3G25570			Adenosylmethionine decarboxyla...		Lus10031919 [exp]	8.3	0.9270

Compare expression of checked genes

Lus10017520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.