Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41560 141 / 3e-45 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028758 [exp] 132 / 5e-42 AT5G41560 88 / 8e-25 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G099200 [exp] 168 / 5e-56 AT5G41560 147 / 9e-48 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10172 [flax] [poplar] DDA1 Det1 complexing ubiquitin ligase
Representative CDS sequence Show only first row Show all	>Lus10017523 pacid=23163214 polypeptide=Lus10017523 locus=Lus10017523.g ID=Lus10017523.BGIv1.0 annot-version=v1.0 ATGGGGTCTATGCTTGGTGACTTGCCTTCATTTGACCCCCACAACTTCAGCCAACTTAGACCCTCCGATCCTTCCAATCCGTCCAAAATGACTCCTGCAA CCTATCATCCAACACACAGTCGTACTCTTCCACCACCTGATCAGGTTATGGCTACTGAAACGAAGAATATCCTTTTAAGAAACTTCTACAAGCGCGCTGA AGAGAAGATGAGACCGAAGCGAGCTGCACCAGAGAGCCTTATACCGGATCATGGTGGCAAGCAGGCGAGGCCTTCTACCTCAAGCTAA
AA sequence Show only first row Show all	>Lus10017523 pacid=23163214 polypeptide=Lus10017523 locus=Lus10017523.g ID=Lus10017523.BGIv1.0 annot-version=v1.0 MGSMLGDLPSFDPHNFSQLRPSDPSNPSKMTPATYHPTHSRTLPPPDQVMATETKNILLRNFYKRAEEKMRPKRAAPESLIPDHGGKQARPSTSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41560			unknown protein		Lus10017523 [exp]	0	1
AT3G60300			RWD domain-containing protein ...		Lus10009773 [exp]	9.4	0.8284
AT1G07570		APK1A	Protein kinase superfamily pro...		Lus10000954 [exp]	19.8	0.8276
AT5G41470			Nuclear transport factor 2 (NT...		Lus10024664 [exp]	21.0	0.8271
AT3G15580		APG8H, ATG8I	AUTOPHAGY 8I, AUTOPHAGY 8H, Ub...		Lus10038046 [exp]	24.5	0.7838
AT3G29130			unknown protein		Lus10000252 [exp]	29.5	0.7584
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10028201 [exp]	30.9	0.8046
AT3G28580			P-loop containing nucleoside t...		Lus10014497 [exp]	32.7	0.8018
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10018138 [exp]	33.2	0.8163
AT1G53025			Ubiquitin-conjugating enzyme f...		Lus10042852 [exp]	36.1	0.8076
AT3G51070			S-adenosyl-L-methionine-depend...		Lus10028354 [exp]	36.8	0.8040

Compare expression of checked genes

Lus10017523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.