Lus10017538 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G23690 186 / 4e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G64160 182 / 2e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 162 / 1e-50 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 161 / 3e-50 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 140 / 4e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 77 / 2e-17 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 70 / 9e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 69 / 2e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49030 71 / 3e-14 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3)
AT5G42500 68 / 4e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024715 251 / 2e-85 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024714 248 / 3e-84 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032331 246 / 1e-83 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017539 176 / 6e-56 AT1G64160 238 / 9e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10028749 174 / 3e-55 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10028750 94 / 6e-25 AT4G23690 52 / 3e-09 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 82 / 1e-19 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 81 / 3e-19 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 79 / 6e-18 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142702 303 / 4e-106 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 303 / 4e-106 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142602 262 / 4e-90 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 262 / 4e-90 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134600 259 / 8e-89 AT1G64160 182 / 5e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 258 / 2e-88 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 258 / 2e-88 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134400 252 / 3e-86 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134800 241 / 1e-81 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096440 182 / 4e-59 AT1G64160 119 / 1e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10017538 pacid=23163131 polypeptide=Lus10017538 locus=Lus10017538.g ID=Lus10017538.BGIv1.0 annot-version=v1.0
ATGGACACCAAACCATCATCAACAACCCTGTTAGCTCTCTCATCATTCCTCCTCCTTTTCTTCCTCGCCAATTCTCAACCATCTCACGATCAACATCATA
ACTACCCTCGAAAGCCACGACCGCAACGTCGTGCCATACCAAAGCCATGCAAGGAGCTAGTCTTCTACTTCCACGACATCATCTACAACGGCAAGAACTC
GAGGAACGCCACCGCGGCCATCGTGGGGGCCCCTGCCTGGGGGAACAGGACCATCCTGGCCGGGCAGAACCACTTTGGTGACGTGGTCGTGTTCGACGAC
CCGATAACGTTGGACAACAACTTGCACGCCCCGGCGGTGGGGCGCGCACAAGGGATGTATGTTTACGACAAGAAGGAAGTGTTCACGGCGTGGTTGGGGT
TCTCGTTCGTGTTTAACTCGACGGAGCATGTGGGGACTCTGACGTTTGCCGGAGCTGATCCGCTGATGAACAAGACGAGGGATGTGTCGGTCGTCGGAGG
CACCGGTGATTTCTTCATGGCTAGAGGGATTGCTACGTTGATGACGGATGCGTTCGAAGGTGAAGTTTATTTTAGGCTGAGGGTTGATATTAAGCTTTAT
GAATGTTGGTGGTGA
AA sequence
>Lus10017538 pacid=23163131 polypeptide=Lus10017538 locus=Lus10017538.g ID=Lus10017538.BGIv1.0 annot-version=v1.0
MDTKPSSTTLLALSSFLLLFFLANSQPSHDQHHNYPRKPRPQRRAIPKPCKELVFYFHDIIYNGKNSRNATAAIVGAPAWGNRTILAGQNHFGDVVVFDD
PITLDNNLHAPAVGRAQGMYVYDKKEVFTAWLGFSFVFNSTEHVGTLTFAGADPLMNKTRDVSVVGGTGDFFMARGIATLMTDAFEGEVYFRLRVDIKLY
ECWW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G23690 Disease resistance-responsive ... Lus10017538 0 1
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Lus10005614 1.0 0.8585
AT5G60020 LAC17, ATLAC17 laccase 17 (.1) Lus10034614 8.3 0.8534
AT3G50830 ATCOR413-PM2, C... cold-regulated 413-plasma memb... Lus10027946 8.4 0.6885
AT5G42180 PER64 peroxidase 64, Peroxidase supe... Lus10017288 8.6 0.8541
AT4G19420 Pectinacetylesterase family pr... Lus10034767 10.6 0.8032
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10004723 13.6 0.7607
AT1G29670 GDSL-like Lipase/Acylhydrolase... Lus10005413 14.7 0.8431
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Lus10032806 16.1 0.8349
AT1G67750 Pectate lyase family protein (... Lus10011400 16.7 0.7763
AT3G04290 ATLTL1, LTL1 Li-tolerant lipase 1 (.1) Lus10004771 18.0 0.8338

Lus10017538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.