Lus10017539 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G64160 219 / 2e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G23690 205 / 1e-67 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11180 169 / 1e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11190 168 / 2e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT4G11210 166 / 2e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 71 / 3e-15 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 66 / 2e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 65 / 4e-13 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G21100 63 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 59 / 4e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10028749 301 / 2e-105 AT1G64160 232 / 2e-78 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10017538 176 / 4e-56 AT4G23690 187 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024715 168 / 5e-53 AT4G23690 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10032331 166 / 3e-52 AT4G23690 187 / 5e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10024714 164 / 2e-51 AT4G23690 186 / 3e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 71 / 8e-15 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 68 / 3e-14 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 68 / 8e-14 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029306 67 / 8e-14 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G142401 232 / 2e-78 AT1G64160 223 / 3e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096560 232 / 2e-78 AT1G64160 223 / 3e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142501 176 / 2e-56 AT1G64160 179 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096680 176 / 3e-56 AT1G64160 178 / 2e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134800 174 / 2e-55 AT1G64160 188 / 4e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142602 173 / 4e-55 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G096800 173 / 4e-55 AT1G64160 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G097001 170 / 5e-54 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.013G142702 170 / 5e-54 AT4G23690 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G134400 169 / 1e-53 AT1G64160 184 / 1e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10017539 pacid=23163197 polypeptide=Lus10017539 locus=Lus10017539.g ID=Lus10017539.BGIv1.0 annot-version=v1.0
ATGAAGCATACTTCTTCCTTTCACTTTCTGTTAACCACAACCACCCTCATCTTCCTCCTCCTCCTCTCACTGATCTCTCCGGGCGATGCCACGTGGCGAA
CGCCATCTCACCACCTGCAACATGCAAAACATCCGAAGCCATGCAAGCAGCTGGTCCTCTACTACCACGACATCCTCTTCCACGGGAACGGCGACCAAGG
GAACGCCACGTCAGCAGCGGCCGCCAACGCCACCAAGCTGGGGGACTACAAGTTCGGGATGCTAGTGGTGTTCGACGACCCCGTGACGAAAGACGGGCAC
CTCAAGTCGAAGGCGGTGGCGCGTGCACAAGGGTTCTACTTCTACGACATGAAGAGCACGTACAACGCGTGGTTCGCGTACACGCTGGTGTTCAACTCGA
CGGACCACAAAGGGACCCTCAACATCATGGGAGCCGACATGATGTCGGAGGAGACCAGGGACCTCTCCGTCGTCGGGGGGACGGGGGATTTCTTCATGGC
GCGTGGGATCGCTACTTTCCGTACGGACACTTTCCAGGGCGATGCCTACTTCCGGTTGGAGATGGATATTAAGTTGTATGAATGTTACTAG
AA sequence
>Lus10017539 pacid=23163197 polypeptide=Lus10017539 locus=Lus10017539.g ID=Lus10017539.BGIv1.0 annot-version=v1.0
MKHTSSFHFLLTTTTLIFLLLLSLISPGDATWRTPSHHLQHAKHPKPCKQLVLYYHDILFHGNGDQGNATSAAAANATKLGDYKFGMLVVFDDPVTKDGH
LKSKAVARAQGFYFYDMKSTYNAWFAYTLVFNSTDHKGTLNIMGADMMSEETRDLSVVGGTGDFFMARGIATFRTDTFQGDAYFRLEMDIKLYECY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G64160 Disease resistance-responsive ... Lus10017539 0 1
AT1G48480 RKL1 receptor-like kinase 1 (.1) Lus10031350 1.7 0.9149
AT5G18520 Lung seven transmembrane recep... Lus10000821 2.8 0.8632
AT3G45230 hydroxyproline-rich glycoprote... Lus10022582 4.7 0.8966
AT2G28780 unknown protein Lus10024409 6.6 0.8843
AT5G49690 UDP-Glycosyltransferase superf... Lus10008955 6.9 0.8728
AT1G49230 RING/U-box superfamily protein... Lus10005818 8.8 0.8859
AT3G45230 hydroxyproline-rich glycoprote... Lus10021479 9.2 0.8728
AT1G65730 YSL7 YELLOW STRIPE like 7 (.1) Lus10017406 11.8 0.8585
AT5G13170 SAG29, SWEET15,... senescence-associated gene 29 ... Lus10003143 12.6 0.8804
AT5G58770 Undecaprenyl pyrophosphate syn... Lus10036178 13.3 0.8541

Lus10017539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.