Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47520 361 / 3e-128 AtRABA5a RAB GTPase homolog A5A (.1) AT2G31680 275 / 3e-94 AtRABA5d RAB GTPase homolog A5D (.1) AT2G43130 272 / 3e-93 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G05810 272 / 1e-92 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT3G07410 266 / 8e-91 AtRABA5b RAB GTPase homolog A5B (.1) AT5G65270 253 / 1e-85 AtRABA4a RAB GTPase homolog A4A (.1) AT4G39990 245 / 2e-82 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1) AT1G07410 243 / 5e-82 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G59150 239 / 4e-80 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT3G46830 239 / 5e-80 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000536 [exp] 401 / 4e-144 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10038807 [exp] 373 / 5e-133 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10026731 [exp] 277 / 4e-95 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 277 / 4e-95 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10039051 [exp] 255 / 1e-87 AT5G47520 259 / 2e-89 RAB GTPase homolog A5A (.1) Lus10000637 [exp] 256 / 5e-87 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1) Lus10023153 [exp] 256 / 1e-86 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10038226 [exp] 254 / 5e-86 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10025876 [exp] 253 / 2e-85 AT1G05810 331 / 1e-116 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G010300 [exp] 365 / 7e-130 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G015400 [exp] 364 / 1e-129 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.002G231800 [exp] 284 / 4e-98 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.014G150300 [exp] 280 / 2e-96 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.002G249500 [exp] 267 / 2e-91 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.007G096000 [exp] 248 / 1e-83 AT5G65270 404 / 2e-145 RAB GTPase homolog A4A (.1) Potri.005G073000 [exp] 247 / 2e-83 AT5G65270 402 / 1e-144 RAB GTPase homolog A4A (.1) Potri.010G197200 [exp] 243 / 1e-81 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 242 / 2e-81 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 241 / 3e-81 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10017558 pacid=23163152 polypeptide=Lus10017558 locus=Lus10017558.g ID=Lus10017558.BGIv1.0 annot-version=v1.0 ATGGCAGTCTACTCTGAAGAGGACAATGCAGATGATTACCTGTTCAAGATTGTACTTATCGGTGATTCCGCTGTCGGAAAGTCGAATCTGCTGGCTAGGT ATGCGAGAGATGAGTTCTACTCGAACTCGAAATCCACTATAGGAGTCGAGTTCCAAACATCAAAGATGGATATCAATGGGAAAGAAGTGAAAGCGCAGAT TTGGGATACGGCTGGTCAGGAGCGGTTTCGAGCTGTAACTTCTGCTTACTATAGGGGTGCAGTTGGTGCCCTTGTTGTCTATGATATCAGTCGACGCCAG ACTTTTGACTCCATTGGCAGATGGCTCAATGAACTTCACACTCACTCAGACATGAACGTGGTGACGATCCTGGTGGGGAACAAGTCGGATCTGAAGGACG CGAGGGAGGTGACGACAGCAGAAGGGAAATCATTGGCGGAGTCGCAAGGATTGTTCTTCATGGAAACGTCTGCGCTGGACTCGTCGAACGTAACGTCTGC TTTCGAGACGGTGGTGAAGGAGATCTACAACATACTGAGTAGAAAGGTGATATCCCAGGAGCTGAAGAAGCAGGATGCGCCGAGTGGGAAGACGGTGGTT TTGAAGGGTGACGATGAGAAGGAAGCCGGCGCCGGTGGTGATGCCGAGGGAGCAAAACAAGGCGGCGGATGTTGTTAA
AA sequence Show only first row Show all	>Lus10017558 pacid=23163152 polypeptide=Lus10017558 locus=Lus10017558.g ID=Lus10017558.BGIv1.0 annot-version=v1.0 MAVYSEEDNADDYLFKIVLIGDSAVGKSNLLARYARDEFYSNSKSTIGVEFQTSKMDINGKEVKAQIWDTAGQERFRAVTSAYYRGAVGALVVYDISRRQ TFDSIGRWLNELHTHSDMNVVTILVGNKSDLKDAREVTTAEGKSLAESQGLFFMETSALDSSNVTSAFETVVKEIYNILSRKVISQELKKQDAPSGKTVV LKGDDEKEAGAGGDAEGAKQGGGCC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10017558 [exp]	0	1
AT3G57040		ATRR4, ARR9	RESPONSE REGULATOR 4, response...		Lus10039524 [exp]	4.0	0.8566
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10027143 [exp]	10.8	0.8332
AT1G13580		LOH3, LAG13	LAG One Homologue 3, LAG1 long...		Lus10013063 [exp]	20.5	0.8271
					Lus10024121 [exp]	21.4	0.8374
AT1G19230			Riboflavin synthase-like super...		Lus10034890 [exp]	21.8	0.8123
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10016212 [exp]	27.7	0.7887
AT5G15290		CASP5	Casparian strip membrane domai...		Lus10015375 [exp]	28.9	0.7964
AT3G20300			Protein of unknown function (D...		Lus10009722 [exp]	29.8	0.8108
AT1G46264	HSF	SCZ, AT-HSFB4	SCHIZORIZA, heat shock transcr...		Lus10026819 [exp]	31.4	0.7687
AT2G27920		SCPL51	serine carboxypeptidase-like 5...		Lus10035555 [exp]	32.0	0.7860

Compare expression of checked genes

Lus10017558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.