Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16490 149 / 2e-44 ARM repeat superfamily protein (.1) AT5G67340 92 / 3e-23 ARM repeat superfamily protein (.1) AT3G01400 91 / 4e-23 ARM repeat superfamily protein (.1) AT2G23140 92 / 5e-23 RING/U-box superfamily protein with ARM repeat domain (.1.2) AT3G54790 89 / 9e-22 ARM repeat superfamily protein (.1.2) AT5G58680 81 / 3e-19 ARM repeat superfamily protein (.1) AT4G12710 62 / 1e-12 ARM repeat superfamily protein (.1) AT3G03440 58 / 5e-11 ARM repeat superfamily protein (.1) AT5G14510 56 / 3e-10 ARM repeat superfamily protein (.1) AT1G71020 53 / 3e-09 ARM repeat superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010499 [exp] 196 / 4e-62 AT4G16490 608 / 0.0 ARM repeat superfamily protein (.1) Lus10038811 [exp] 164 / 4e-54 AT4G16490 160 / 2e-48 ARM repeat superfamily protein (.1) Lus10039047 [exp] 165 / 9e-51 AT4G16490 549 / 0.0 ARM repeat superfamily protein (.1) Lus10011514 [exp] 96 / 4e-24 AT2G23140 916 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10019308 [exp] 93 / 2e-23 AT2G23140 911 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10007738 [exp] 91 / 7e-23 AT3G01400 555 / 0.0 ARM repeat superfamily protein (.1) Lus10032023 [exp] 90 / 1e-22 AT2G23140 309 / 1e-98 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10011516 [exp] 87 / 3e-21 AT2G23140 410 / 5e-134 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10024899 [exp] 79 / 2e-18 AT2G23140 551 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G010800 [exp] 155 / 8e-47 AT4G16490 521 / 0.0 ARM repeat superfamily protein (.1) Potri.006G015100 [exp] 141 / 2e-41 AT4G16490 509 / 1e-178 ARM repeat superfamily protein (.1) Potri.007G051000 [exp] 97 / 7e-25 AT2G23140 1018 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Potri.005G144700 [exp] 96 / 3e-24 AT2G23140 972 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2) Potri.005G225400 [exp] 85 / 1e-20 AT3G54790 736 / 0.0 ARM repeat superfamily protein (.1.2) Potri.002G118800 [exp] 84 / 1e-20 AT3G01400 521 / 0.0 ARM repeat superfamily protein (.1) Potri.014G016400 [exp] 84 / 1e-20 AT3G01400 557 / 0.0 ARM repeat superfamily protein (.1) Potri.002G037700 [exp] 85 / 2e-20 AT3G54790 707 / 0.0 ARM repeat superfamily protein (.1.2) Potri.014G170100 [exp] 67 / 2e-14 AT4G12710 422 / 3e-147 ARM repeat superfamily protein (.1) Potri.017G128100 [exp] 66 / 6e-14 AT3G03440 380 / 2e-130 ARM repeat superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017562 pacid=23163170 polypeptide=Lus10017562 locus=Lus10017562.g ID=Lus10017562.BGIv1.0 annot-version=v1.0 ATGGTTGTACTCAACAGCCTTGCAGGGATTGAAGAAGGAAGGGATGCAATTGTGGAGGAAGGAGGAATTGTTGCGCTGGTGGAAGCCATAGAAGACTGTT CACCTAAAGGGAAAGAGTTCTCTGTGTTGACACTGCTCCAATTGTGCTCTGTAAGTATTAGGAACCGAGGGTTGCTGGTGAGGGAAGGTGGGATTCCTCC TCTCGTCGCCCTGTCGCAAACCGGAACTGCCCGTGCTAAGCACAAGGCAGAGTCACTTCTGGTGTACTTGAGAGAATCAAGGCAGGAGGCTTCTACTTCT TCTCCTTGA
AA sequence Show only first row Show all	>Lus10017562 pacid=23163170 polypeptide=Lus10017562 locus=Lus10017562.g ID=Lus10017562.BGIv1.0 annot-version=v1.0 MVVLNSLAGIEEGRDAIVEEGGIVALVEAIEDCSPKGKEFSVLTLLQLCSVSIRNRGLLVREGGIPPLVALSQTGTARAKHKAESLLVYLRESRQEASTS SP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16490			ARM repeat superfamily protein...		Lus10017562 [exp]	0	1
AT4G16490			ARM repeat superfamily protein...		Lus10017563 [exp]	1.0	0.9702
AT3G21890	CO		B-box type zinc finger family ...		Lus10031583 [exp]	2.0	0.9407
AT5G51720			2 iron, 2 sulfur cluster bindi...		Lus10031686 [exp]	2.0	0.9481
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032481 [exp]	2.4	0.9419
AT5G51720			2 iron, 2 sulfur cluster bindi...		Lus10031105 [exp]	3.2	0.9375
AT4G16490			ARM repeat superfamily protein...		Lus10010499 [exp]	4.2	0.9338
AT3G18490			Eukaryotic aspartyl protease f...		Lus10032482 [exp]	8.0	0.9086
AT4G25130		PMSR4	peptide met sulfoxide reductas...		Lus10032504 [exp]	8.8	0.9147
AT3G47070			unknown protein		Lus10040689 [exp]	9.5	0.9084
AT5G24460			unknown protein		Lus10015572 [exp]	10.8	0.8941

Compare expression of checked genes

Lus10017562 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.