Lus10017581 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02510 619 / 0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
AT5G16040 613 / 0 Regulator of chromosome condensation (RCC1) family protein (.1)
AT5G63860 181 / 2e-52 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1)
AT5G60870 134 / 6e-35 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3)
AT3G26100 131 / 4e-34 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
AT5G19420 125 / 9e-31 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
AT5G12350 122 / 4e-30 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
AT5G11580 119 / 2e-29 Regulator of chromosome condensation (RCC1) family protein (.1)
AT5G08710 116 / 1e-28 RUG1 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1)
AT3G02300 115 / 4e-28 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033543 737 / 0 AT3G02510 648 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Lus10039618 171 / 1e-48 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1)
Lus10042215 144 / 1e-38 AT5G60870 547 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3)
Lus10029536 135 / 2e-35 AT5G63860 642 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1)
Lus10035957 132 / 1e-34 AT5G08710 504 / 1e-178 RCC1/UVR8/GEF-like 1, Regulator of chromosome condensation (RCC1) family protein (.1)
Lus10036030 125 / 7e-31 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Lus10009701 124 / 1e-30 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Lus10011399 122 / 4e-30 AT3G26100 805 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Lus10006455 122 / 4e-30 AT3G26100 809 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G101800 665 / 0 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Potri.017G113200 663 / 0 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Potri.007G100200 177 / 6e-51 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1)
Potri.004G000600 125 / 1e-31 AT5G60870 534 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3)
Potri.016G101700 122 / 1e-30 AT3G53830 547 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1)
Potri.017G139600 123 / 3e-30 AT1G65920 937 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1)
Potri.015G009400 120 / 1e-29 AT3G26100 809 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Potri.001G276900 117 / 2e-28 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
Potri.012G018600 115 / 4e-28 AT3G26100 798 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2)
Potri.009G071800 116 / 7e-28 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0186 Beta_propeller PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence
>Lus10017581 pacid=23155465 polypeptide=Lus10017581 locus=Lus10017581.g ID=Lus10017581.BGIv1.0 annot-version=v1.0
ATGGCTACTCGTACCTCAGTCATCGCCTGGGGCGCAGGCGAAGACGGGCAGCTGGGAATAGGCGACAATGAAGACAGGGAGTGGGTCTGCGTCGTCAAAG
CTCTCCAACCCTACAAAGTCCGATCCGTCGTTGCCGGAAGCCGCAACTCTCTTGCCATTTGCGACGATGGCAAGCTGTTTACTTGGGGATGGAACCAGAG
AGGGACGCTGGGTCGCCAACCGGAGACCAAGATTGAAAATGTTCCAAGTCAAGTGAAAGCCCTCGCCGATGTCAATATTGTTCAGGCGGCTATTGGTGGA
TGGCATTGCTTGGCTGTTGATGATCAAGTGCGAGCTTACGCTTGGGGTGGGAACGAGTACGGGCAATGCGGTGAAGAACCTGAGCGCAAGGATGACACGG
GGAGGCTACTGAGGAGGGATATAGTTATTCCTCAGCGTTGTGCTCCGAAGCTTGCAGTTCAACAGGTGGTTTATGTTGAAGAGTTAGCGGCTGGCGGTAC
ACATTCAGTGGTGCTTACACGTGAAGGCCATGTATGGACATGGGGTCAACCATGGCCTCCTGGTGACATCAAGCAAATCTCTGTTCCTGTGCGGGTACAA
GGCCTTGATAAAGTGAGACTCATTGCCGTGGGGGCATTTCATAATTTAGCTCTTAAAGAAGATGGAACCCTGTGGGCATGGGGCAATAATGAATACGGGC
AACTCGGAACTGGTGATACCCAGCCAAGATCACAGCCTATACTTGTCCAAGGGCTGTCTGGTCTCAATTTGGTTGACATTGCCGCTGGAGGATGGCATTC
CACCACACTAACCAAGGATGGCGAGGTGTATGGCTGGGGGAGAGGTGAGCATGGAAGACTGGGTTTCGGTGACAACGACAAGAGCAGCAAAATGGTTCCC
CAGAAGGTTAACCTGTTGACAGGGGAGGAAATAGTTCAGGTATCGTGCGGTGGGACGCACTCAGTGGCACTGACGAAAGATGGCAGGGTGTTCTCGTTCG
GGAGAGGTGACCATGGTAGATTAGGTAACGGGAGGAAGGCGACTACAGGGCAGCCAATGAAAGTACCAATCACCAGAGCAGAAGAAGATGGTGAAGAAGA
AGAGGAAGAAGAAGAGTGGAGGGCGAAGCTTGTGGCGTGTGGAGGAAGACACACATTGGCAGTTGTAGAGTGGGAAGAAGAAGAGCAGCAAACGCACACC
ACTGACTAA
AA sequence
>Lus10017581 pacid=23155465 polypeptide=Lus10017581 locus=Lus10017581.g ID=Lus10017581.BGIv1.0 annot-version=v1.0
MATRTSVIAWGAGEDGQLGIGDNEDREWVCVVKALQPYKVRSVVAGSRNSLAICDDGKLFTWGWNQRGTLGRQPETKIENVPSQVKALADVNIVQAAIGG
WHCLAVDDQVRAYAWGGNEYGQCGEEPERKDDTGRLLRRDIVIPQRCAPKLAVQQVVYVEELAAGGTHSVVLTREGHVWTWGQPWPPGDIKQISVPVRVQ
GLDKVRLIAVGAFHNLALKEDGTLWAWGNNEYGQLGTGDTQPRSQPILVQGLSGLNLVDIAAGGWHSTTLTKDGEVYGWGRGEHGRLGFGDNDKSSKMVP
QKVNLLTGEEIVQVSCGGTHSVALTKDGRVFSFGRGDHGRLGNGRKATTGQPMKVPITRAEEDGEEEEEEEEWRAKLVACGGRHTLAVVEWEEEEQQTHT
TD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G02510 Regulator of chromosome conden... Lus10017581 0 1
AT3G05670 RING/U-box protein (.1) Lus10015213 3.0 0.8461
AT3G21220 ATMAP2K_ALPHA, ... ARABIDOPSIS THALIANA MITOGEN-A... Lus10037340 3.5 0.8324
AT5G61030 GR-RBP3 glycine-rich RNA-binding prote... Lus10021154 5.3 0.8427
AT5G59550 zinc finger (C3HC4-type RING f... Lus10040783 6.2 0.8365
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Lus10043184 6.6 0.8038
AT5G42130 AtMfl1 MitoFerrinLike1, Mitochondrial... Lus10042797 6.7 0.7915
AT4G16570 ATPRMT7 ARABIDOPSIS THALIANA PROTEIN A... Lus10008510 7.9 0.7882
AT1G60690 NAD(P)-linked oxidoreductase s... Lus10037437 8.9 0.8298
AT2G31200 ADF6, ATADF6 actin depolymerizing factor 6 ... Lus10022933 11.7 0.8271
AT4G08980 FBW2 F-BOX WITH WD-40 2 (.1.2.3.4.5... Lus10010351 14.5 0.7890

Lus10017581 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.