Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16060 134 / 1e-42 Cytochrome c oxidase biogenesis protein Cmc1-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033547 [exp] 138 / 2e-44 AT5G16060 108 / 8e-33 Cytochrome c oxidase biogenesis protein Cmc1-like (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G113401 [exp] 155 / 5e-51 AT5G16060 139 / 2e-44 Cytochrome c oxidase biogenesis protein Cmc1-like (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0351 [flax] [poplar] CHCH PF08583 [flax] [poplar] Cmc1 Cytochrome c oxidase biogenesis protein Cmc1 like
Representative CDS sequence Show only first row Show all	>Lus10017586 pacid=23155562 polypeptide=Lus10017586 locus=Lus10017586.g ID=Lus10017586.BGIv1.0 annot-version=v1.0 ATGGGTTACCTTCAGGAAGCTCGTGAGAATCACGTAAAGAAGAAGGTCGAGGAAGCTTTGATCAGTAAAATGAAGCACAAGGCACTGAAAGAATGTGAAC ATCTCGCTTCACAGTACGCACAATGTGCTACCGGAAGAACACTTTCCGTTGTGTGGCAGTGTCGGAAACAAGCCAAGGAGCTGAATTCCTGCCTGCATCA GTTCACAAATGATACTGTGTTGGAGGAGATGAAGAAAGAGTACAACCTGCAACAGCAGCAAGGTGGAAAGGAGCCGGCGACACTGTGA
AA sequence Show only first row Show all	>Lus10017586 pacid=23155562 polypeptide=Lus10017586 locus=Lus10017586.g ID=Lus10017586.BGIv1.0 annot-version=v1.0 MGYLQEARENHVKKKVEEALISKMKHKALKECEHLASQYAQCATGRTLSVVWQCRKQAKELNSCLHQFTNDTVLEEMKKEYNLQQQQGGKEPATL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10017586 [exp]	0	1
AT5G16060			Cytochrome c oxidase biogenesi...		Lus10033547 [exp]	1.7	0.8627
AT3G26115			Pyridoxal-5'-phosphate-depende...		Lus10036952 [exp]	2.0	0.7576
AT1G76860			Small nuclear ribonucleoprotei...		Lus10011293 [exp]	7.6	0.8104
AT3G07910			unknown protein		Lus10039527 [exp]	10.8	0.7777
AT1G20580			Small nuclear ribonucleoprotei...		Lus10030747 [exp]	12.2	0.7399
AT1G51650			ATP synthase epsilon chain, mi...		Lus10034841 [exp]	15.0	0.7076
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10024229 [exp]	21.2	0.7115
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Lus10023599 [exp]	21.2	0.7195
AT5G53650			unknown protein		Lus10032946 [exp]	24.0	0.7113
AT2G24830	C3HZnF		zinc finger (CCCH-type) family...		Lus10026901 [exp]	26.8	0.7157

Compare expression of checked genes

Lus10017586 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.