Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13340 158 / 3e-46 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G34220 101 / 1e-24 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G35730 99 / 6e-24 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G25420 91 / 1e-21 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) AT2G19710 91 / 1e-20 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G52315 87 / 6e-20 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G79910 87 / 1e-19 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G29440 86 / 5e-19 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G32350 78 / 2e-16 Regulator of Vps4 activity in the MVB pathway protein (.1) AT2G14830 72 / 2e-14 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033552 [exp] 357 / 8e-125 AT1G13340 208 / 6e-64 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10041468 [exp] 191 / 2e-58 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10034303 [exp] 183 / 1e-55 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10017592 [exp] 158 / 9e-47 AT1G13340 178 / 3e-52 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10033553 [exp] 103 / 8e-26 AT1G13340 107 / 6e-26 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10000978 [exp] 102 / 8e-25 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10040542 [exp] 101 / 2e-24 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10041836 [exp] 99 / 7e-24 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10006061 [exp] 97 / 4e-23 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G113900 [exp] 189 / 2e-59 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.010G127000 [exp] 184 / 8e-56 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.004G100900 [exp] 184 / 2e-54 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.006G149800 [exp] 108 / 4e-27 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.007G059800 [exp] 100 / 2e-24 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.019G087400 [exp] 98 / 2e-23 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.013G117100 [exp] 98 / 3e-23 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.008G121300 [exp] 95 / 6e-23 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Potri.004G038600 [exp] 85 / 9e-19 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.013G135700 [exp] 84 / 1e-18 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03398 [flax] [poplar] Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence Show only first row Show all	>Lus10017591 pacid=23155536 polypeptide=Lus10017591 locus=Lus10017591.g ID=Lus10017591.BGIv1.0 annot-version=v1.0 ATGGGTAGGAAGCTGGATGCTCCTCTAGGAAGAAACTTCAGAGCATCCAGGTTCATGGCTTTAACCACTGTTGCAATCTCAAGGATTGTCATTCTCAAAA GGCAGAGGCATTCCAGGTTTTCCCAGGCAAAGTCTGATGTTATTGAACTCCTTAATCTTGACCAACATGACAGAGCTCTCATTCGCGTTGAGCTTGTCGT CAAGGACCGTCTTATGCTTGATGCATTCGACATGATCCGAAGCTACTGTGAGCTGCTGAAAGAAAGAGTCTTGCTTCTCCAAAAGACCAAAGAATGCCCA GATGAGCTTAAGGAGCCAATCTCAAGCTTGATCTTTGCATCGTCAAGGTGTGCAGAGTTCCCTGAGCTCCAAGAGATGCGCGTGGTTTGCCAAGTGCAAT TTGGGAAGGAGTTTGTTGCTCGCCATCGAGCTGCAAAACAATTGTGCTGTGAATCCCAAGCAAGACAGCCGAGTTTAGAAAGCAGGATTGAAGAGCTGAG AAGCATTGCCTCTGAGGTTAATATCATCCTAGATTTGAAACTTCATGTTCAACCGCAGAAACCTGATGCGTCTCGAAAGCAAGAACCTGAGAAGTCGGAT GCATGGTTGGAAGACAGTGCTCATAAAAAGCCAAGGCTGCTCAATCGCAATCTTCAGGTTCAGATGAAGAGTTCTCTGAGTCGCTGA
AA sequence Show only first row Show all	>Lus10017591 pacid=23155536 polypeptide=Lus10017591 locus=Lus10017591.g ID=Lus10017591.BGIv1.0 annot-version=v1.0 MGRKLDAPLGRNFRASRFMALTTVAISRIVILKRQRHSRFSQAKSDVIELLNLDQHDRALIRVELVVKDRLMLDAFDMIRSYCELLKERVLLLQKTKECP DELKEPISSLIFASSRCAEFPELQEMRVVCQVQFGKEFVARHRAAKQLCCESQARQPSLESRIEELRSIASEVNIILDLKLHVQPQKPDASRKQEPEKSD AWLEDSAHKKPRLLNRNLQVQMKSSLSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G13340			Regulator of Vps4 activity in ...		Lus10017591 [exp]	0	1
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10040762 [exp]	8.0	0.8161
AT1G66980		GDPDL2, SNC4	Glycerophosphodiester phosphod...		Lus10040037 [exp]	9.6	0.8166
					Lus10038105 [exp]	11.5	0.7819
AT1G79800		AtENODL7	early nodulin-like protein 7 (...		Lus10011433 [exp]	27.1	0.7033
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Lus10012479 [exp]	28.8	0.7993
AT3G09270		ATGSTU8	glutathione S-transferase TAU ...		Lus10040763 [exp]	31.6	0.7099
AT1G05200		GLUR3, ATGLR3.4	glutamate receptor 3.4 (.1.2)		Lus10005276 [exp]	31.9	0.7698
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Lus10015268 [exp]	36.6	0.7742
AT3G58060			Cation efflux family protein (...		Lus10029300 [exp]	42.3	0.7019
AT5G24090		ATCHIA	chitinase A (.1)		Lus10037984 [exp]	48.2	0.6666

Compare expression of checked genes

Lus10017591 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.