Lus10017592 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13340 173 / 2e-50 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 137 / 1e-36 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 138 / 4e-36 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G25420 126 / 2e-33 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT2G19710 120 / 1e-29 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G29440 115 / 4e-28 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G79910 87 / 6e-19 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 87 / 7e-19 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT4G32350 79 / 1e-15 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G52315 71 / 1e-13 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033553 364 / 3e-125 AT1G13340 107 / 6e-26 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041468 208 / 2e-63 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10034303 206 / 1e-62 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10033552 203 / 2e-62 AT1G13340 208 / 6e-64 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10017591 157 / 4e-46 AT1G13340 158 / 3e-46 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028724 138 / 1e-36 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10041836 138 / 1e-36 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10006061 137 / 2e-36 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10028383 134 / 2e-35 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G127000 221 / 2e-68 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.017G113900 207 / 5e-65 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G100900 203 / 7e-60 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.019G087400 146 / 3e-39 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G117100 140 / 3e-37 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.008G121300 134 / 2e-36 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.007G059800 134 / 4e-35 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.006G149800 129 / 1e-32 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G038600 99 / 2e-22 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G135700 98 / 3e-22 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10017592 pacid=23155460 polypeptide=Lus10017592 locus=Lus10017592.g ID=Lus10017592.BGIv1.0 annot-version=v1.0
ATGGCGATGAAGAAGAAGCTGGACGCTCTGTTGGGGAGATCTTTCAAAAGCTCGAGGTTCAAACACCTGGCAGGTTTGGTCATCGCCCGGATCTCGCACT
TCGAGAAGCAGCACAAGTCCCGCTGCTCCCAGGCTCGCCGCGATGTCTCTCAGCTCCTCCTCGACGGCCACCTCGAACGCGCTCTCCAACGCGTTGAGTA
TGCGATCAGGGAGCAGAACATGCTGGATTCCTATGCCATGATCGACAACTACTGCCATCTCCTTAGTGAAAGGCTCGTCGTTATCGAGACCAATTATTCC
AAGGAATGTCCAGATGAGCTGAAGGAGGCAATAGCAAGTTTGATCTTTGCGGCGGCGAGGTGTGGGGAATTGCCGGAGCTTCAAGAGATGAAAAGGCTCT
TCAGTTGTAGATACGGCAAGGAATTCACCACTCGCGCCGCTGAAATGCGGAATAACTGTGGAGTCCACCCAAGGATTGCAAAGAAGCTGTCGACCAAGCA
ACCAAGCCTGGAAAGCAAAATCAGTGCCCTAAAGGAAATAGCTCCAAAATGTGAACTCATCCCACACTTAGATGAAGTGGCCTCTTCACTCCCCAAATCA
CCACCTGCTAGCAGTCATAATTCTCATCATCACCACGCCATTGTAGTTGACGAGACGCACGAGCACGACTCGGCTGCATCCCCTGCACGGTTTGGTCCGA
CACCATCGAGGAGCTACTCCGATAGGTACCCAGATTTCGAGGCTGCAGTCCACGCAGCCTGTGAGCTATCAGCTCAGGCCGCGGCTGCAGCCAGAGCTGC
CATGGAGCTCTCTTCTAGGCCTCCCACTAATGACGACGATGATTCGAGTTCGGATAGGAATAATAATGGTGTTAGTTCAGCATTGAAGTTATTGAGGAGG
AGCAATACTACTGCTAGTGGTTTTGATGCCAATGGAAAATCTAGGGTTGTTGTGTCATCATCATCGGACTATGTTCCCAAGTTGTTCAAGAGAAGTTCTA
GTACCGTTACAACAGTGTTCGATCTTCACCCTCCGAATGTTAGAAGGTGA
AA sequence
>Lus10017592 pacid=23155460 polypeptide=Lus10017592 locus=Lus10017592.g ID=Lus10017592.BGIv1.0 annot-version=v1.0
MAMKKKLDALLGRSFKSSRFKHLAGLVIARISHFEKQHKSRCSQARRDVSQLLLDGHLERALQRVEYAIREQNMLDSYAMIDNYCHLLSERLVVIETNYS
KECPDELKEAIASLIFAAARCGELPELQEMKRLFSCRYGKEFTTRAAEMRNNCGVHPRIAKKLSTKQPSLESKISALKEIAPKCELIPHLDEVASSLPKS
PPASSHNSHHHHAIVVDETHEHDSAASPARFGPTPSRSYSDRYPDFEAAVHAACELSAQAAAAARAAMELSSRPPTNDDDDSSSDRNNNGVSSALKLLRR
SNTTASGFDANGKSRVVVSSSSDYVPKLFKRSSSTVTTVFDLHPPNVRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13340 Regulator of Vps4 activity in ... Lus10017592 0 1
Lus10019746 3.9 0.6532
AT1G68460 ATIPT1 Arabidopsis thaliana isopenten... Lus10041440 23.5 0.6291
AT3G50310 MKKK20, MAPKKK2... MAPKK kinase 20, mitogen-activ... Lus10034242 36.0 0.4992
AT1G70460 AtPERK13, RHS10 proline-rich extensin-like rec... Lus10013013 53.4 0.4990
AT3G02210 COBL1 COBRA-like protein 1 precursor... Lus10033047 55.0 0.5061
AT3G44220 Late embryogenesis abundant (L... Lus10034175 57.1 0.5020
Lus10001078 69.7 0.5056
AT5G39020 Malectin/receptor-like protein... Lus10008333 72.2 0.5031
AT5G03340 ATPase, AAA-type, CDC48 protei... Lus10037385 77.2 0.4876
AT5G57750 RING/U-box superfamily protein... Lus10016542 92.3 0.4838

Lus10017592 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.