Lus10017597 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G38410 271 / 2e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
AT5G38420 271 / 3e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
AT1G67090 270 / 7e-94 RBCS1A ribulose bisphosphate carboxylase small chain 1A (.1.2)
AT5G38430 269 / 1e-93 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033558 360 / 1e-129 AT5G38410 272 / 1e-94 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Lus10009172 310 / 1e-109 AT5G38420 264 / 2e-91 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10028471 309 / 3e-109 AT5G38420 265 / 1e-91 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Lus10034357 188 / 2e-61 AT1G67090 182 / 7e-59 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Lus10005093 187 / 3e-61 AT5G38420 186 / 3e-60 Ribulose bisphosphate carboxylase (small chain) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G100000 268 / 4e-93 AT1G67090 286 / 3e-100 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Potri.017G114600 264 / 2e-91 AT1G67090 292 / 2e-102 ribulose bisphosphate carboxylase small chain 1A (.1.2)
Potri.018G091401 191 / 6e-63 AT5G38410 183 / 1e-59 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
Potri.006G167901 0 / 1 AT5G38410 0 / 1 Ribulose bisphosphate carboxylase (small chain) family protein (.1), Ribulose bisphosphate carboxylase (small chain) family protein (.2), Ribulose bisphosphate carboxylase (small chain) family protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00101 RuBisCO_small Ribulose bisphosphate carboxylase, small chain
PF12338 RbcS Ribulose-1,5-bisphosphate carboxylase small subunit
Representative CDS sequence
>Lus10017597 pacid=23155547 polypeptide=Lus10017597 locus=Lus10017597.g ID=Lus10017597.BGIv1.0 annot-version=v1.0
ATGGCTTCAATGATTTCTTCCACCGCAGTTAGCCGAGCCACCGTTGCTCAGGCCAGTTTGATCGCTCCGTTCACCGGACTTAAGTCCGCCTCCGCCTTCC
CCGTCACCACCAAGAAGGCCTCCATCCCAAGCAACGGCAGCAGAGTGCAGTGCATGAAGGTGTGGCCACCAATTGGTTTGAAGAAGTACGAGACCCTGTC
GTACCTTCCCCCGTTGTCACAGGAGGCGTTGGCTAAGGAGGTCGACTACCTTCTCCGCATGGGATGGGTTCCTTGCTTGGAATTCGAGTTGGAGCACGGT
TTCGTGTACCGTGAGTACAACAGCTCGCCAGGGTACTATGACGGAAGGTACTGGACAATGTGGAAGCTGCCCATGTTCGGGTGCACTGACTCATCGCAGG
TGTTGAAGGAGCTAGAGGAGTGCGTGAAGGAGTACCCGACCGCCTTCGTCCGTATCATCGGATTCGACAACAAGCGTCAAGTGCAGTGCATCAGTTTCAT
TGCCGCCAAGCCCGAAGGCTACTAA
AA sequence
>Lus10017597 pacid=23155547 polypeptide=Lus10017597 locus=Lus10017597.g ID=Lus10017597.BGIv1.0 annot-version=v1.0
MASMISSTAVSRATVAQASLIAPFTGLKSASAFPVTTKKASIPSNGSRVQCMKVWPPIGLKKYETLSYLPPLSQEALAKEVDYLLRMGWVPCLEFELEHG
FVYREYNSSPGYYDGRYWTMWKLPMFGCTDSSQVLKELEECVKEYPTAFVRIIGFDNKRQVQCISFIAAKPEGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G38410 Ribulose bisphosphate carboxyl... Lus10017597 0 1
AT5G38410 Ribulose bisphosphate carboxyl... Lus10033558 1.0 0.9927
AT5G38420 Ribulose bisphosphate carboxyl... Lus10009172 2.8 0.9531
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Lus10013448 3.5 0.9601
AT3G54050 HCEF1 high cyclic electron flow 1 (.... Lus10021115 5.2 0.9593
AT1G74730 Protein of unknown function (D... Lus10042179 6.5 0.9520
AT1G12900 GAPA-2 glyceraldehyde 3-phosphate deh... Lus10012591 6.5 0.9503
AT1G14150 PnsL2, PQL2, PQ... PsbQ-like 1, Photosynthetic ND... Lus10037159 7.2 0.9421
AT1G55480 ZKT protein containing PDZ domain,... Lus10013403 7.4 0.9440
AT1G32080 AtLrgB membrane protein, putative (.1... Lus10010412 7.5 0.9483
AT1G09340 CSP41B, CRB, HI... heteroglycan-interacting prote... Lus10001525 7.7 0.9528

Lus10017597 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.