Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38195 90 / 6e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 86 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G48750 86 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G18280 86 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G14846 84 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38180 79 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 77 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43667 76 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 75 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38197 74 / 7e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033573 [exp] 139 / 3e-44 AT5G38195 92 / 9e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033574 [exp] 84 / 2e-22 AT3G18280 97 / 8e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017616 [exp] 83 / 6e-22 AT3G18280 100 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10029131 [exp] 66 / 2e-15 AT3G18280 108 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10013030 [exp] 66 / 3e-15 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042449 [exp] 40 / 8e-05 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G118700 [exp] 81 / 3e-21 AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G044500 [exp] 80 / 6e-21 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 74 / 1e-18 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G096000 [exp] 70 / 3e-17 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017615 pacid=23155497 polypeptide=Lus10017615 locus=Lus10017615.g ID=Lus10017615.BGIv1.0 annot-version=v1.0 ATGAAGCTTTTATCTCTGATCTTCCTTGCGGCGGCGGTTATGGCGGTGGTCATCACGAGTGAAGCAGAGTGTGCGGCGGCGGCGGCTGACTGCACCCCGA TGGACCTGCTCCCATGCCTGCCGGCGATTACGTCGGGGTCGGCGCCGACAAAAGAATGCTGCGGGAAGCTGAAGGATCAGGAGGATTGCCTGTGTGGGTA CTCGAAGAATCCTGATTTTGGGAAATATGTCTCTTCTCCTAACGCCAAAAAGGTCATCGACGCCTGTGCTGTTCCTCACCCTTCTTGTTGA
AA sequence Show only first row Show all	>Lus10017615 pacid=23155497 polypeptide=Lus10017615 locus=Lus10017615.g ID=Lus10017615.BGIv1.0 annot-version=v1.0 MKLLSLIFLAAAVMAVVITSEAECAAAAADCTPMDLLPCLPAITSGSAPTKECCGKLKDQEDCLCGYSKNPDFGKYVSSPNAKKVIDACAVPHPSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38195			Bifunctional inhibitor/lipid-t...		Lus10017615 [exp]	0	1
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10026138 [exp]	3.2	0.9223
AT2G18180			Sec14p-like phosphatidylinosit...		Lus10028332 [exp]	6.0	0.9214
AT2G43610			Chitinase family protein (.1)		Lus10001772 [exp]	7.1	0.9423
AT2G22330		CYP79B3	"cytochrome P450, family 79, s...		Lus10042319 [exp]	10.3	0.8127
AT1G22130	MADS	AGL104	AGAMOUS-like 104 (.1)		Lus10022506 [exp]	10.9	0.9337
					Lus10009439 [exp]	11.7	0.9276
AT3G03080			Zinc-binding dehydrogenase fam...		Lus10003638 [exp]	16.0	0.9256
					Lus10032670 [exp]	20.6	0.9205
AT1G75750		GASA1	GAST1 protein homolog 1 (.1.2)		Lus10034524 [exp]	21.7	0.9212
					Lus10009618 [exp]	25.1	0.9196

Compare expression of checked genes

Lus10017615 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.