Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18280 91 / 8e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G48750 89 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G66850 84 / 5e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38160 82 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38170 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38195 78 / 7e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73780 76 / 5e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G43667 67 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G14846 66 / 4e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G38180 66 / 4e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033574 [exp] 126 / 7e-39 AT3G18280 97 / 8e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10017615 [exp] 83 / 1e-21 AT5G38195 91 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033573 [exp] 82 / 2e-21 AT5G38195 92 / 9e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10013030 [exp] 66 / 3e-15 AT3G18280 109 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10029131 [exp] 66 / 5e-15 AT3G18280 108 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G118700 [exp] 96 / 6e-27 AT3G18280 87 / 5e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G044500 [exp] 83 / 6e-22 AT3G18280 109 / 8e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.012G054300 [exp] 80 / 2e-20 AT3G18280 103 / 3e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G096000 [exp] 75 / 8e-19 AT3G18280 82 / 6e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10017616 pacid=23155437 polypeptide=Lus10017616 locus=Lus10017616.g ID=Lus10017616.BGIv1.0 annot-version=v1.0 ATGAAGCCGACGGCAACAACGTTCCTCTTCTTCGCGGCGACGGCGGCGGCTATGCTGATCATGATCATGGCTGCTGGGCCCGGCGGAGCAGAGGCGGCGA GGCCGGCGGCAGATGCTACTTGTAACCCTTCGGAGCTGAGCCCGTGCGCGGGGGCGCTAACATCGGGGGCCCCGCCATCTGGAGCGTGCTGCGGGAAGCT GAAGCAGCAGCAGCCGTGCCTGTGTGGGTACATAAGGAACCCAAACTTCAGGCAGTTCGTAACTGCACCAGGTGCTCAACGTGTTCTCCGTTCCTGTGGC GTTGCTTACCCTTCCTGCTGCTCATATGATCAATTGTCGTATTGCATCGCCACCGTCCGCTTTTTCAATTAA
AA sequence Show only first row Show all	>Lus10017616 pacid=23155437 polypeptide=Lus10017616 locus=Lus10017616.g ID=Lus10017616.BGIv1.0 annot-version=v1.0 MKPTATTFLFFAATAAAMLIMIMAAGPGGAEAARPAADATCNPSELSPCAGALTSGAPPSGACCGKLKQQQPCLCGYIRNPNFRQFVTAPGAQRVLRSCG VAYPSCCSYDQLSYCIATVRFFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10017616 [exp]	0	1
AT3G18280			Bifunctional inhibitor/lipid-t...		Lus10033574 [exp]	1.0	0.9662
AT2G39705		RTFL8, DVL11	DEVIL 11, ROTUNDIFOLIA like 8 ...		Lus10024323 [exp]	2.4	0.8753
AT2G29700		ATPH1	pleckstrin homologue 1 (.1)		Lus10040681 [exp]	4.2	0.8409
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10011215 [exp]	9.5	0.8109
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10013434 [exp]	10.8	0.8627
AT1G09310			Protein of unknown function, D...		Lus10018630 [exp]	11.6	0.8038
AT5G62470	MYB	ATMYB96, mybcov...	myb domain protein 96 (.1.2)		Lus10002056 [exp]	16.0	0.8469
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Lus10015631 [exp]	16.2	0.8079
AT2G30300			Major facilitator superfamily ...		Lus10042234 [exp]	22.1	0.8276
AT5G23140		NCLPP7, NCLPP2,...	nuclear-encoded CLP protease P...		Lus10040981 [exp]	22.7	0.8514

Compare expression of checked genes

Lus10017616 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.