Lus10017627 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10017627 pacid=23155459 polypeptide=Lus10017627 locus=Lus10017627.g ID=Lus10017627.BGIv1.0 annot-version=v1.0
ATGAACAATCCAATAGCTCATTGGAAGAAGCTGTTGAGGAGCATCACCATGAGGTGGTCTTTTTGCAGGTATCCGAAATTCCAGATAGATGATTGTTCAG
AGCTCTTGGGTTCCAATGCAGATTTTGTTGAGATGAAAAGCAGAGATGAGTATGAATCTATAAGAATCGGAAAGAGCATTGATGACGTTCTAGAATTGTT
GAATGAAAATGATCGGAAGCAAGTCGCTTCGCCTGTTGAAATAGAGAAGGCCGCTTATTTGTTGAGCCTAAGACTGGATGGGCACCCGCCTGAGGAGAAA
TGCAGAGCCTTGATTGCAGAAGGAGTACGAACTCTTGACGAAGTGAAACCACTACATGCCAGGCTTCTTGATACGAGGTCAGTTGTGGACATGGTCAATT
CTTCTCAATCCTTCCAGTTACTTATCTGGGGTTTTCCTTTCTCCAAAAGCTTAAATCCATCAATCCTTTTGTTTGAAAATGACATCTCAATCATTGGAGA
CCTTGTCAAGAAGGTGACGTCTAGAAGACGAGCAGCGGAGGAGTTACTGACATGA
AA sequence
>Lus10017627 pacid=23155459 polypeptide=Lus10017627 locus=Lus10017627.g ID=Lus10017627.BGIv1.0 annot-version=v1.0
MNNPIAHWKKLLRSITMRWSFCRYPKFQIDDCSELLGSNADFVEMKSRDEYESIRIGKSIDDVLELLNENDRKQVASPVEIEKAAYLLSLRLDGHPPEEK
CRALIAEGVRTLDEVKPLHARLLDTRSVVDMVNSSQSFQLLIWGFPFSKSLNPSILLFENDISIIGDLVKKVTSRRRAAEELLT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10017627 0 1
AT2G24100 ASG1 ALTERED SEED GERMINATION 1, un... Lus10029847 1.0 0.9184
AT2G25344 LCR14 low-molecular-weight cysteine-... Lus10014355 4.1 0.8496
AT5G04885 Glycosyl hydrolase family prot... Lus10008434 4.4 0.8218
AT3G53710 AGD6 ARF-GAP domain 6 (.1.2) Lus10012991 5.5 0.9171
AT2G43870 Pectin lyase-like superfamily ... Lus10011417 6.7 0.9171
Lus10039432 7.7 0.9171
AT1G02335 GL22 germin-like protein subfamily ... Lus10004856 8.7 0.9171
AT3G19270 CYP707A4 "cytochrome P450, family 707, ... Lus10014056 9.5 0.9171
Lus10002332 10.2 0.9171
AT3G05950 RmlC-like cupins superfamily p... Lus10023351 11.0 0.9171

Lus10017627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.