Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G17980 241 / 1e-82 AtC2 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT5G37740 230 / 2e-78 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G73580 229 / 6e-78 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G66360 227 / 5e-77 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G48590 222 / 4e-75 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) AT1G70810 196 / 1e-64 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G70790 191 / 8e-63 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT2G01540 184 / 8e-60 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G70800 178 / 8e-58 EHB1 ENHANCED BENDING 1, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G23140 173 / 6e-56 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033585 [exp] 327 / 8e-117 AT3G17980 244 / 1e-83 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10009684 [exp] 228 / 3e-76 AT3G17980 254 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10009053 [exp] 228 / 3e-76 AT3G17980 255 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10042002 [exp] 211 / 2e-70 AT1G48590 240 / 6e-82 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) Lus10018005 [exp] 196 / 2e-64 AT3G17980 222 / 1e-74 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10021775 [exp] 176 / 1e-56 AT1G70810 209 / 6e-70 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10001594 [exp] 160 / 4e-50 AT3G17980 187 / 7e-61 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10034591 [exp] 148 / 4e-46 AT1G70790 181 / 3e-59 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Lus10003710 [exp] 135 / 3e-41 AT1G48590 158 / 2e-50 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G125500 [exp] 244 / 6e-84 AT3G17980 249 / 6e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.004G089500 [exp] 242 / 3e-83 AT3G17980 245 / 4e-84 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.012G047100 [exp] 237 / 4e-81 AT3G17980 251 / 2e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.010G110900 [exp] 202 / 6e-67 AT1G70790 233 / 3e-79 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.008G131500 [exp] 199 / 7e-66 AT3G17980 202 / 5e-67 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.006G004600 [exp] 138 / 3e-42 AT5G47710 270 / 3e-94 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.016G005300 [exp] 136 / 2e-41 AT5G47710 264 / 1e-91 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.011G098500 [exp] 128 / 2e-36 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.001G372000 [exp] 128 / 3e-36 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.003G198301 [exp] 123 / 2e-33 AT3G07940 503 / 7e-178 Calcium-dependent ARF-type GTPase activating protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [flax] [poplar] C2 PF00168 [flax] [poplar] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Lus10017629 pacid=23155441 polypeptide=Lus10017629 locus=Lus10017629.g ID=Lus10017629.BGIv1.0 annot-version=v1.0 ATGGAGAACATGATGGGACTTCTGAGGATGACGGTGGTCAGAGGGATCAACCTCGCCGTTAGAGACGTCAGGAGCAGCGATCCTTATGTTATCGTCAAGA TGGGCAAACAGAAGCTAAAGACTCGAGTAGTGAAGAAAAACGTCAACCCAGAGTGGAACGAAACTTTGACCCTTTCAGTAACCGACCCGAATCTTCCCGT CAAGATTGAAGTGTACGACAGGGACTTGTACAGCAGGGACGACATGATGGGGAATGCAGAGTTCGACATCGGCCCTTTCGTGGAAGCCGTGAGGATGAAG CTGAACGGGTTGCCAAGTGGGACCATAATCACCAGAGTGCATCCCAGCAGGAAGAACTACCTCTCTGAGGAGAGCAATGTGGTGTGGGTCAATGATGAAG TGGTGCAGAAGCTCTTCCTCAGGCTGGGGAATGTCGAGTGCGGGGAGGTCGAGCTCGACCTCCATTGGATTGACATCCCTGGCTCCAAGGGTCTCAAGTA G
AA sequence Show only first row Show all	>Lus10017629 pacid=23155441 polypeptide=Lus10017629 locus=Lus10017629.g ID=Lus10017629.BGIv1.0 annot-version=v1.0 MENMMGLLRMTVVRGINLAVRDVRSSDPYVIVKMGKQKLKTRVVKKNVNPEWNETLTLSVTDPNLPVKIEVYDRDLYSRDDMMGNAEFDIGPFVEAVRMK LNGLPSGTIITRVHPSRKNYLSEESNVVWVNDEVVQKLFLRLGNVECGEVELDLHWIDIPGSKGLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10017629 [exp]	0	1
AT3G52450		PUB22	plant U-box 22 (.1)		Lus10029393 [exp]	1.4	0.9743
AT3G52710			unknown protein		Lus10017030 [exp]	3.9	0.9656
AT4G14746			unknown protein		Lus10039368 [exp]	4.2	0.9635
AT1G72390			unknown protein		Lus10013170 [exp]	6.5	0.9494
AT2G18890			Protein kinase superfamily pro...		Lus10025468 [exp]	6.6	0.9620
AT2G03340	WRKY	WRKY3	WRKY DNA-binding protein 3 (.1...		Lus10036800 [exp]	9.2	0.9606
AT3G59710			NAD(P)-binding Rossmann-fold s...		Lus10035736 [exp]	9.9	0.9670
AT2G40600			appr-1-p processing enzyme fam...		Lus10029040 [exp]	10.7	0.9655
AT3G46510		ATPUB13	ARABIDOPSIS THALIANA PLANT U-B...		Lus10007511 [exp]	10.8	0.9660
AT2G38740			Haloacid dehalogenase-like hyd...		Lus10040116 [exp]	11.5	0.9657

Compare expression of checked genes

Lus10017629 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.