Lus10017636 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G03380 223 / 3e-67 DEG7, DEGP7 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017637 310 / 1e-99 AT3G03380 618 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Lus10033594 293 / 7e-92 AT3G03380 592 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Lus10042507 262 / 2e-81 AT3G03380 1144 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Lus10009122 226 / 4e-68 AT3G03380 814 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Lus10028521 176 / 2e-50 AT3G03380 1385 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Lus10038155 59 / 3e-10 AT3G03380 94 / 1e-21 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G128300 225 / 9e-68 AT3G03380 1694 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Potri.004G088600 220 / 3e-66 AT3G03380 1442 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
Potri.004G088700 217 / 6e-65 AT3G03380 1365 / 0.0 degradation of periplasmic proteins 7, DegP protease 7 (.1)
PFAM info
Representative CDS sequence
>Lus10017636 pacid=23155542 polypeptide=Lus10017636 locus=Lus10017636.g ID=Lus10017636.BGIv1.0 annot-version=v1.0
ATGATGCTTACCAATTTATGGTATAAACATCTACGGCTTTCGATTCTGGCTGGTACTGTTGCTCGCGTGGATCGAGATGCACCTTGCTGCGAAGATGATG
GCTACAACAACTTTAATACGTTCTATATCCAAGCGGCATCAGGAACCAAAGGTGGTTCAAGTGGTTCTCCAGTAATTGAGAAACAAGGCAGAGCAGTTGC
CTTAAATGCTGGAGGCACTGCCGGCAGTAGCGCATCTGGGTTCTTCCTGCCTCTAGAACGGGTCGTTAGAGCACTCCAGCTTTTACAGCAAGGCAAAGAT
TTCGACACCGATACATGGAGTGCTGTCTGCATTCCCCGCGGTACAGTTCAGGCAACTTTTAACCACAAAGCATTCAACGAGATTCGCCGACTTGGGGTCA
GGAAAGAACGAGAAGAGATGGTGCGACAAGTTTTCCCCAGTGGAATTGGAATGCTTGTTGTGCACACAGTGGTACCGGATGGTCCAGCTTCGAAACATTT
GGAACCTGGGGATGTACTTGAACGCTTGAATCACGAGGTCACCACAAGCTTTTCATCCTTGGAGTCGGTTCTCGAAAGGGGCGACAAGACTCTTACCGTA
CACATAACCCCCGATAGTTTTTTGGAACCGAGCAGCGCAGTTATACATTCTTTGTCGTATCAACAGGGATAA
AA sequence
>Lus10017636 pacid=23155542 polypeptide=Lus10017636 locus=Lus10017636.g ID=Lus10017636.BGIv1.0 annot-version=v1.0
MMLTNLWYKHLRLSILAGTVARVDRDAPCCEDDGYNNFNTFYIQAASGTKGGSSGSPVIEKQGRAVALNAGGTAGSSASGFFLPLERVVRALQLLQQGKD
FDTDTWSAVCIPRGTVQATFNHKAFNEIRRLGVRKEREEMVRQVFPSGIGMLVVHTVVPDGPASKHLEPGDVLERLNHEVTTSFSSLESVLERGDKTLTV
HITPDSFLEPSSAVIHSLSYQQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G03380 DEG7, DEGP7 degradation of periplasmic pro... Lus10017636 0 1
AT2G24280 alpha/beta-Hydrolases superfam... Lus10024449 3.5 0.9247
AT4G11530 CRK34 cysteine-rich RLK (RECEPTOR-li... Lus10022285 5.3 0.8971
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023904 6.5 0.8971
Lus10010383 7.5 0.8971
Lus10000380 8.4 0.8971
AT2G39080 EMB2799 EMBRYO DEFECTIVE 2799, NAD(P)-... Lus10037911 9.2 0.8962
Lus10009632 9.9 0.8938
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10015092 11.3 0.8789
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10039502 13.1 0.8678
AT5G18190 Protein kinase family protein ... Lus10043244 13.7 0.8460

Lus10017636 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.