Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21930 130 / 5e-41 unknown protein AT3G42150 130 / 9e-41 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011614 [exp] 164 / 4e-53 AT3G42150 132 / 2e-40 unknown protein Lus10031451 [exp] 132 / 6e-42 AT3G42150 104 / 6e-31 unknown protein Lus10033601 [exp] 132 / 6e-40 ND 111 / 2e-31
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G086300 [exp] 146 / 2e-47 AT1G21930 140 / 4e-45 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017643 pacid=23155517 polypeptide=Lus10017643 locus=Lus10017643.g ID=Lus10017643.BGIv1.0 annot-version=v1.0 ATGGCAGAGCATCAAGAGAAAGTTAAGCACATTGAGGAGTGTTCAGTTGCAAATGCCATGGGGACATGGTTCTTTTCAGCAGCTGGGGCTCTGATAGCGA TTCCAGTTGGGATAAAGCGCAAGTCATTAGCTCCACTGGTGTTCTTCGGCACAACGGGGACAATGCTTGATATTATAATGGGTATCAGCCAATGTGAAAG AGAATATGCAGAGCGCCAAGCATTGCTACTAGAAACCCAGAATGCGCCAGCAGCAGCAGGTGGTGGAGATTTCACCGAAACAGTGTCTTCAGACTCATGA
AA sequence Show only first row Show all	>Lus10017643 pacid=23155517 polypeptide=Lus10017643 locus=Lus10017643.g ID=Lus10017643.BGIv1.0 annot-version=v1.0 MAEHQEKVKHIEECSVANAMGTWFFSAAGALIAIPVGIKRKSLAPLVFFGTTGTMLDIIMGISQCEREYAERQALLLETQNAPAAAGGGDFTETVSSDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G42150			unknown protein		Lus10017643 [exp]	0	1
AT5G05360			unknown protein		Lus10012213 [exp]	16.9	0.7852
AT3G49890			unknown protein		Lus10019282 [exp]	29.5	0.7167
AT1G33980		ATUPF3, UPF3	Smg-4/UPF3 family protein (.1....		Lus10009488 [exp]	31.7	0.7312
AT1G12650			unknown protein		Lus10017837 [exp]	41.1	0.7367
AT1G14620		XTR2, EXGT-A2, ...	decoy (.1.2)		Lus10030524 [exp]	56.7	0.7173
AT1G20770			unknown protein		Lus10030736 [exp]	74.6	0.7021
AT5G06210			RNA binding (RRM/RBD/RNP motif...		Lus10013306 [exp]	81.2	0.7147
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10014103 [exp]	83.4	0.6829
AT5G04490		VTE5	vitamin E pathway gene 5 (.1)		Lus10017447 [exp]	91.0	0.6914
AT3G51150			ATP binding microtubule motor ...		Lus10033920 [exp]	95.4	0.6638

Compare expression of checked genes

Lus10017643 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.