Lus10017648 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42740 315 / 1e-111 RPL16A ribosomal protein large subunit 16A (.1)
AT5G45775 315 / 1e-111 Ribosomal L5P family protein (.1.2)
AT4G18730 315 / 1e-111 RPL16B ribosomal protein L16B (.1)
AT3G58700 315 / 1e-111 Ribosomal L5P family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033607 327 / 3e-116 AT2G42740 362 / 7e-130 ribosomal protein large subunit 16A (.1)
Lus10020715 321 / 5e-114 AT2G42740 359 / 5e-129 ribosomal protein large subunit 16A (.1)
Lus10029824 309 / 4e-109 AT2G42740 347 / 5e-124 ribosomal protein large subunit 16A (.1)
Lus10007915 51 / 6e-08 AT4G01310 364 / 3e-128 Ribosomal L5P family protein (.1)
Lus10036390 51 / 9e-08 AT4G01310 349 / 1e-121 Ribosomal L5P family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G069200 320 / 2e-113 AT2G42740 318 / 1e-112 ribosomal protein large subunit 16A (.1)
Potri.011G068900 319 / 2e-113 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2)
Potri.006G181600 319 / 2e-113 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2)
Potri.006G181501 319 / 2e-113 AT5G45775 320 / 1e-113 Ribosomal L5P family protein (.1.2)
Potri.002G109701 112 / 3e-33 AT2G42740 127 / 5e-39 ribosomal protein large subunit 16A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00673 Ribosomal_L5_C ribosomal L5P family C-terminus
CL0652 S24e_L23_L15e PF00281 Ribosomal_L5 Ribosomal protein L5
Representative CDS sequence
>Lus10017648 pacid=23155489 polypeptide=Lus10017648 locus=Lus10017648.g ID=Lus10017648.BGIv1.0 annot-version=v1.0
ATGAGGGAAATCAAGGTCCAGAAGCTGGTCCTCAACATATCCGTCGGCGAGAGCGGCGATCGCCTCACCAGAGCTGCTAAGGTGTTGGAACAACTCAGTG
GACAGACCCCTGTCTTCTCCAAAGCAAGGTACACTGTTAGGTCCTTTGGTATCAGGCGTAATGAGAAGATTGCCTGCTATGTCACTGTGAGAGGAGACAA
GGCGATGCAACTGTTGGAAAGTGGATTGAAGGTGAAGGAGTACGAACTCCTCAGGAGGAACTTTAGCGATACTGGATGCTTTGGGTTCGGTATTCAGGAG
CACATTGATTTGGGTATCAAGTACGATCCTTCCACTGGTATTTACGGAATGGACTTCTTTGTCGTCCTCGAGCGACCTGGGTACCGTGTTGCCCGTCGCC
GTAGGTGCAAGGCCCGCGTTGGTATTCACCAGAGGGTAACCAAGGATGATGCCATGAAGTGGTTCCAGGTCAAATATGAAGGAGTTATCCTCAACAAGGC
TCAGAACATTACTGGTTAA
AA sequence
>Lus10017648 pacid=23155489 polypeptide=Lus10017648 locus=Lus10017648.g ID=Lus10017648.BGIv1.0 annot-version=v1.0
MREIKVQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVFSKARYTVRSFGIRRNEKIACYVTVRGDKAMQLLESGLKVKEYELLRRNFSDTGCFGFGIQE
HIDLGIKYDPSTGIYGMDFFVVLERPGYRVARRRRCKARVGIHQRVTKDDAMKWFQVKYEGVILNKAQNITG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G42740 RPL16A ribosomal protein large subuni... Lus10017648 0 1
AT2G42740 RPL16A ribosomal protein large subuni... Lus10033607 1.0 0.9823
AT1G48830 Ribosomal protein S7e family p... Lus10028789 2.4 0.9772
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10040332 2.4 0.9779
AT5G09510 Ribosomal protein S19 family p... Lus10033856 3.5 0.9764
AT2G09990 Ribosomal protein S5 domain 2-... Lus10035133 5.7 0.9543
AT3G16080 Zinc-binding ribosomal protein... Lus10037549 5.9 0.9661
AT5G35530 Ribosomal protein S3 family pr... Lus10030503 6.3 0.9684
AT4G16720 Ribosomal protein L23/L15e fam... Lus10028965 8.4 0.9599
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10015588 8.8 0.9675
AT1G17880 ATBTF3 basic transcription factor 3 (... Lus10015123 8.8 0.9563

Lus10017648 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.