Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G34760 124 / 9e-37 RHS5, GF14OMICRON, GRF11 ROOT HAIR SPECIFIC 5, general regulatory factor 11 (.1.2) AT2G42590 123 / 2e-36 GENERALREGULATORYFACTOR9, GF14MU, GRF9 general regulatory factor 9 (.1.2.3) AT1G22300 122 / 4e-36 14-3-3EPSILON, GF14EPSILON, GRF10 14-3-3 PROTEIN G-BOX FACTOR14 EPSILON, general regulatory factor 10 (.1.2.3) AT1G26480 121 / 1e-35 GF14IOTA, GRF12 general regulatory factor 12 (.1) AT4G09000 114 / 5e-33 GF14CHI, GRF1 GENERAL REGULATORY FACTOR1-G-BOX FACTOR 14-3-3 HOMOLOG ISOFORM CHI, general regulatory factor 1 (.1.2) AT5G38480 110 / 2e-31 RCI1, GRF3 general regulatory factor 3 (.1.2) AT1G35160 110 / 2e-31 14-3-3PHI, GF14PHI, GRF4 ,GF14 PHI GENERAL REGULATORY FACTOR 4, 14-3-3 PROTEIN G-BOX FACTOR14 PHI, GF14 protein phi chain (.1.2) AT1G78300 109 / 4e-31 14-3-3OMEGA, GF14OMEGA, GRF2 14-3-3 PROTEIN G-BOX FACTOR14 OMEGA, general regulatory factor 2 (.1) AT3G02520 108 / 8e-31 GENERALREGULATORYFACTOR7, GF14NU, GRF7 general regulatory factor 7 (.1) AT5G65430 104 / 3e-29 14-3-3KAPPA, GF14KAPPA, GRF8 14-3-3 PROTEIN G-BOX FACTOR14 KAPPA, general regulatory factor 8 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017650 [exp] 149 / 1e-46 AT2G42590 420 / 5e-150 general regulatory factor 9 (.1.2.3) Lus10033609 [exp] 148 / 1e-44 AT2G42590 410 / 9e-144 general regulatory factor 9 (.1.2.3) Lus10029835 [exp] 138 / 4e-42 AT2G42590 417 / 1e-148 general regulatory factor 9 (.1.2.3) Lus10020705 [exp] 138 / 5e-42 AT2G42590 399 / 2e-141 general regulatory factor 9 (.1.2.3) Lus10001894 [exp] 135 / 3e-41 AT2G42590 405 / 1e-144 general regulatory factor 9 (.1.2.3) Lus10013908 [exp] 136 / 6e-40 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10037090 [exp] 127 / 3e-39 AT1G26480 274 / 4e-94 general regulatory factor 12 (.1) Lus10036896 [exp] 128 / 3e-38 AT1G26480 462 / 5e-167 general regulatory factor 12 (.1) Lus10004652 [exp] 125 / 3e-37 AT1G26480 457 / 4e-165 general regulatory factor 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G110900 [exp] 130 / 2e-39 AT2G42590 424 / 4e-152 general regulatory factor 9 (.1.2.3) Potri.001G392200 [exp] 130 / 2e-39 AT2G42590 428 / 2e-153 general regulatory factor 9 (.1.2.3) Potri.005G164500 [exp] 126 / 8e-38 AT1G34760 417 / 3e-149 ROOT HAIR SPECIFIC 5, general regulatory factor 11 (.1.2) Potri.008G095000 [exp] 125 / 3e-37 AT1G26480 440 / 3e-158 general regulatory factor 12 (.1) Potri.002G097500 [exp] 124 / 5e-37 AT1G26480 419 / 4e-150 general regulatory factor 12 (.1) Potri.010G159300 [exp] 123 / 1e-36 AT1G26480 466 / 2e-168 general regulatory factor 12 (.1) Potri.004G101700 [exp] 109 / 4e-31 AT3G02520 472 / 5e-171 general regulatory factor 7 (.1) Potri.017G113300 [exp] 108 / 9e-31 AT3G02520 468 / 2e-169 general regulatory factor 7 (.1) Potri.005G162400 [exp] 105 / 9e-30 AT1G78300 475 / 2e-172 14-3-3 PROTEIN G-BOX FACTOR14 OMEGA, general regulatory factor 2 (.1) Potri.002G099800 [exp] 104 / 3e-29 AT1G78300 473 / 3e-171 14-3-3 PROTEIN G-BOX FACTOR14 OMEGA, general regulatory factor 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00244 [flax] [poplar] 14-3-3 14-3-3 protein
Representative CDS sequence Show only first row Show all	>Lus10017652 pacid=23155457 polypeptide=Lus10017652 locus=Lus10017652.g ID=Lus10017652.BGIv1.0 annot-version=v1.0 ATGGCTGAAAGAGACCAATTCGTCTACACTGCCAAGCTCGCCGAGCAAGCTGAACGCTACGAAGAAATGGTGGAAGCGATGAAGAATTTGGCGAAGCTAG ATGTGGAGCTGACGATCGAGGAGAGGAACTTGCTCTCTGTTGGCTACAAGAACGTGATCGGTGCTCGGCGAGCGTCGTGGAGGATTCTGTCGTCCATTGA GCAGAAGGAAGAGTCGAGAGGAGAAAGCCAAGCGGAGGCATAG
AA sequence Show only first row Show all	>Lus10017652 pacid=23155457 polypeptide=Lus10017652 locus=Lus10017652.g ID=Lus10017652.BGIv1.0 annot-version=v1.0 MAERDQFVYTAKLAEQAERYEEMVEAMKNLAKLDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESRGESQAEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Lus10017652 [exp]	0	1
AT1G60780		HAP13	HAPLESS 13, Clathrin adaptor c...		Lus10026688 [exp]	3.2	0.8103
AT1G79830		GC5	golgin candidate 5 (.1.2.3.4)		Lus10011437 [exp]	5.7	0.8093
AT5G03040		IQD2	IQ-domain 2 (.1.2.3)		Lus10019916 [exp]	7.3	0.7931
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Lus10017650 [exp]	10.5	0.7961
AT1G64060		RBOHAP108, ATRB...	ARABIDOPSIS THALIANA RESPIRATO...		Lus10028755 [exp]	10.9	0.7636
AT2G38020		EMB258, MAN, VC...	VACUOLELESS 1, MANGLED, vacuol...		Lus10012203 [exp]	12.0	0.7696
AT5G46630			Clathrin adaptor complexes med...		Lus10040086 [exp]	12.0	0.7826
AT4G24550			Clathrin adaptor complexes med...		Lus10003537 [exp]	16.2	0.7817
AT1G04760		ATVAMP726	vesicle-associated membrane pr...		Lus10038342 [exp]	19.0	0.7953
AT2G30910		ARPC1B, ARPC1, ...	actin-related protein C1A (.1....		Lus10031375 [exp]	21.9	0.7692

Compare expression of checked genes

Lus10017652 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.