Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16890 312 / 4e-111 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) AT1G78870 309 / 4e-110 UBC35 ,UBC13A UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) AT1G64230 157 / 4e-50 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G41700 157 / 4e-50 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 157 / 5e-50 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G53300 156 / 1e-49 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 156 / 2e-49 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT2G16740 155 / 4e-49 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 149 / 5e-47 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT3G08700 142 / 3e-44 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033611 [exp] 314 / 6e-112 AT1G16890 311 / 5e-111 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10000353 [exp] 317 / 5e-105 AT1G16890 313 / 3e-103 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10000615 [exp] 289 / 2e-96 AT1G16890 286 / 9e-95 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10021385 [exp] 156 / 2e-49 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 155 / 4e-49 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10039323 [exp] 155 / 4e-49 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 155 / 5e-49 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 155 / 5e-49 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 154 / 9e-49 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G392500 [exp] 308 / 1e-109 AT1G78870 310 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.011G111400 [exp] 308 / 2e-109 AT1G78870 311 / 1e-110 UBIQUITIN CONJUGATING ENZYME 13A, ubiquitin-conjugating enzyme 35 (.1.2.3) Potri.019G131400 [exp] 157 / 6e-50 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.016G138900 [exp] 157 / 7e-50 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.003G136200 [exp] 155 / 2e-49 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 155 / 2e-49 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.001G094900 [exp] 155 / 4e-49 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.015G023300 [exp] 154 / 1e-48 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 154 / 1e-48 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.011G168200 [exp] 153 / 2e-48 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [flax] [poplar] UBC PF00179 [flax] [poplar] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Lus10017654 pacid=23155475 polypeptide=Lus10017654 locus=Lus10017654.g ID=Lus10017654.BGIv1.0 annot-version=v1.0 ATGGCGAACAGCAATCTTCCTCGCAGAATCATCAAGGAAACGCAGCGGCTCCTCAGTGAACCAGCTCCAGGAATCAGTGCTTCTCCTTCAGAAGAGAACA TGCGATACTTCAATGTGATGATTCTTGGTCCAACACAATCGCCTTATGAAGGTGGTGTTTTCAAGTTGGAATTGTTCTTACCTGAAGAATACCCAATGGC ACCTCCCAAGGTTCGCTTCCTGACCAAAATTTACCACCCTAACATTGACAAGCTCGGAAGGATTTGCCTTGATATCCTGAAAGACAAGTGGAGTCCAGCA CTTCAAATCCGAACAGTTCTGCTAAGCATCCAAGCTCTATTGAGTGCTCCGAATCCTGATGATCCGCTGTCTGAGAACATCGCCAAGCACTGGAAATCAA ATGAAGCTGAAGCTGTTGAAACAGCTAAAGAATGGACTCGCCTATATGCAAGTGGTGCGTGA
AA sequence Show only first row Show all	>Lus10017654 pacid=23155475 polypeptide=Lus10017654 locus=Lus10017654.g ID=Lus10017654.BGIv1.0 annot-version=v1.0 MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPA LQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTRLYASGA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G16890		UBC36 ,UBC13B	UBIQUITIN CONJUGATING ENZYME 1...		Lus10017654 [exp]	0	1
AT3G04780			Protein of unknown function (D...		Lus10020246 [exp]	4.7	0.8294
AT1G19860	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Lus10024316 [exp]	6.2	0.8289
AT1G16890		UBC36 ,UBC13B	UBIQUITIN CONJUGATING ENZYME 1...		Lus10033611 [exp]	6.6	0.7805
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Lus10019047 [exp]	7.2	0.8054
AT1G59650		CW14	Protein of unknown function (D...		Lus10010740 [exp]	8.0	0.7972
AT1G64230		UBC28	ubiquitin-conjugating enzyme 2...		Lus10027570 [exp]	17.1	0.8204
AT5G22950		VPS24.1	SNF7 family protein (.1)		Lus10021423 [exp]	17.7	0.8018
AT1G19130			unknown protein		Lus10039920 [exp]	19.4	0.7939
AT5G66450			Phosphatidic acid phosphatase ...		Lus10028326 [exp]	20.5	0.7170
AT5G28830			calcium-binding EF hand family...		Lus10015916 [exp]	22.2	0.7508

Compare expression of checked genes

Lus10017654 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.