Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03770 90 / 1e-22 AtKdtA, KDTA KDO transferase A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033622 [exp] 130 / 2e-37 AT5G03770 488 / 7e-172 KDO transferase A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G095900 [exp] 102 / 3e-27 AT5G03770 538 / 0.0 KDO transferase A (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017664 pacid=23155528 polypeptide=Lus10017664 locus=Lus10017664.g ID=Lus10017664.BGIv1.0 annot-version=v1.0 ATGGCGGCTGCGGCAAATGGGTTGCTGTTCTCCAAGATCTACAGGGCGTTAACCTTCACTCTTTCACCGACCGTACATCTTCATTTGCGGTGGCACAAGC TCCGTGGCATCGAGCACCCTACGCGGTGGCCTGAGCGGCTCGGCCGAGCTTCTCTCGCCCGGCCGCCTGGTCCACTCGTCTGGTTTCACGCCGTATCCTT AGGTCTGAGAAGGAATGGAAGCTCATGTTTGGCAAAAGAGTTTAAGCTGAATCGCAGATTTTTGAAAAATGGTTGA
AA sequence Show only first row Show all	>Lus10017664 pacid=23155528 polypeptide=Lus10017664 locus=Lus10017664.g ID=Lus10017664.BGIv1.0 annot-version=v1.0 MAAAANGLLFSKIYRALTFTLSPTVHLHLRWHKLRGIEHPTRWPERLGRASLARPPGPLVWFHAVSLGLRRNGSSCLAKEFKLNRRFLKNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03770		AtKdtA, KDTA	KDO transferase A (.1)		Lus10017664 [exp]	0	1
AT2G40570			initiator tRNA phosphoribosyl ...		Lus10012958 [exp]	8.8	0.6981
					Lus10034709 [exp]	16.1	0.7775
AT1G55750			BSD domain (BTF2-like transcri...		Lus10007089 [exp]	31.4	0.7325
AT3G16560			Protein phosphatase 2C family ...		Lus10008378 [exp]	31.5	0.6967
AT3G25610			ATPase E1-E2 type family prote...		Lus10035069 [exp]	58.2	0.6586
AT5G01310	bHLH	APTX, bHLH140	APRATAXIN-like (.1)		Lus10002216 [exp]	87.6	0.6246
AT5G52660	MYB		Homeodomain-like superfamily p...		Lus10039284 [exp]	95.3	0.6947
AT5G08110			nucleic acid binding;ATP-depen...		Lus10007978 [exp]	105.9	0.6838
AT5G23720		PHS1	PROPYZAMIDE-HYPERSENSITIVE 1, ...		Lus10043195 [exp]	137.6	0.6554
AT3G03300		ATDCL2, DCL2	dicer-like 2 (.1.2.3)		Lus10036447 [exp]	141.3	0.6614

Compare expression of checked genes

Lus10017664 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.