Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31090 43 / 6e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033620 [exp] 49 / 2e-08 AT1G06240 303 / 2e-101 Protein of unknown function DUF455 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G090500 [exp] 50 / 7e-10 AT2G31090 42 / 8e-07 unknown protein Potri.011G063900 [exp] 40 / 1e-05 AT2G31090 59 / 3e-13 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017667 pacid=23155438 polypeptide=Lus10017667 locus=Lus10017667.g ID=Lus10017667.BGIv1.0 annot-version=v1.0 ATGTGCTGCGATGGAGATTGCAGACCTTTGGGGTTCCTATTGGGTCTTCCCTTTGCTTTCCTTTCTCTCCTCATCTCCATTGTTGGCATCGTCATCTGGA TTGTCGGGTTGTTGTTGACTTGTATATGCCCTTGCTGCTTGTGCGTGACGATCATCGTCGAATTGGCTCTGGAGCTCATCAAGGCTCCCATTCATGTCAT GGAGTGGTTCACTTCTCAGATTCCTTGCTGA
AA sequence Show only first row Show all	>Lus10017667 pacid=23155438 polypeptide=Lus10017667 locus=Lus10017667.g ID=Lus10017667.BGIv1.0 annot-version=v1.0 MCCDGDCRPLGFLLGLPFAFLSLLISIVGIVIWIVGLLLTCICPCCLCVTIIVELALELIKAPIHVMEWFTSQIPC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31090			unknown protein		Lus10017667 [exp]	0	1
AT4G32180		ATPANK2	pantothenate kinase 2 (.1.2.3)		Lus10013019 [exp]	2.8	0.9602
AT4G19860			alpha/beta-Hydrolases superfam...		Lus10017142 [exp]	3.7	0.9383
AT2G24550			unknown protein		Lus10026939 [exp]	4.5	0.9530
AT1G68300			Adenine nucleotide alpha hydro...		Lus10041436 [exp]	7.3	0.9437
AT1G15740			Leucine-rich repeat family pro...		Lus10008036 [exp]	8.7	0.9480
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10022727 [exp]	11.4	0.9486
AT1G15740			Leucine-rich repeat family pro...		Lus10038107 [exp]	13.4	0.9406
AT4G37180	GARP		Homeodomain-like superfamily p...		Lus10019639 [exp]	15.2	0.9401
AT5G53050			alpha/beta-Hydrolases superfam...		Lus10022392 [exp]	16.9	0.9326
AT2G10950			BSD domain-containing protein ...		Lus10027706 [exp]	17.3	0.9383

Compare expression of checked genes

Lus10017667 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.