Lus10017679 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60860 425 / 5e-154 AtRABA1f RAB GTPase homolog A1F (.1)
AT3G15060 409 / 1e-147 AtRABA1g RAB GTPase homolog A1G (.1)
AT1G28550 393 / 4e-141 AtRABA1i RAB GTPase homolog A1I (.1)
AT4G18430 386 / 2e-138 AtRABA1e RAB GTPase homolog A1E (.1)
AT2G33870 386 / 2e-138 ArRABA1h RAB GTPase homolog A1H (.1)
AT4G18800 365 / 3e-130 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT5G45750 360 / 5e-128 AtRABA1c RAB GTPase homolog A1C (.1)
AT1G16920 343 / 2e-121 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT1G06400 342 / 4e-121 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
AT1G09630 312 / 4e-109 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002178 438 / 4e-159 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Lus10015297 422 / 1e-152 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10025432 417 / 2e-150 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10039895 412 / 7e-149 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1)
Lus10013961 407 / 9e-147 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10029253 361 / 2e-128 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 358 / 4e-127 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10020746 334 / 8e-118 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Lus10029789 333 / 1e-117 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G123600 429 / 2e-155 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.019G092500 429 / 2e-155 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.001G374000 414 / 2e-149 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.011G061300 409 / 1e-147 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
Potri.011G070300 361 / 1e-128 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 361 / 2e-128 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.003G004100 311 / 8e-109 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.006G000300 303 / 2e-105 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.008G061300 300 / 2e-104 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 297 / 3e-103 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10017679 pacid=23155505 polypeptide=Lus10017679 locus=Lus10017679.g ID=Lus10017679.BGIv1.0 annot-version=v1.0
ATGGGGGCGTACAGGGCAGACGACGATTACGATTACCTCTTCAAGGTGGTGTTGATCGGCGACTCCGGCGTCGGGAAATCCAATCTTCTCTCCAGGTTCA
CCAGGAACGAGTTCAGCCTCGAGTCCAAATCCACGATCGGCGTGGAATTCGCCACCCGCAGCATCCACGTCGATGATAAGGTCGTCAAGGCCCAGATTTG
GGACACTGCTGGCCAGGAAAGATACCGTGCAATCACCAGCGCATACTACAGAGGCGCAGTCGGTGCTTTGCTAGTCTACGACGTAACCCGACACGTTACT
TTCGAAAACGTCGAGAGGTGGCTCAAGGAGCTCAGGGATCACACCGATGCCAACATCGTGATCATGCTCGTCGGGAACAAGGCAGATCTCCGACACCTCC
GTGCTGTCCAGACCGAGGATTCCAAGGCGTTTGCAGAGAGGGAGAACACGTATTTCATGGAAACATCGGCACTCGAGTCCCTGAACGTTGAGAACGCCTT
CACCGAGGTGCTCAGTCAGATCTACCGCGTCGTCAGCCGGAAAGCACTCGATGTGGGAGACGACCCAGCAGCCTTGCCCAAGGGACAGACTATCAATGTG
GGGAAAGATGATGTATCAGCAGTGAAGAAAGTCGGATGCTGCTCAGCTTAG
AA sequence
>Lus10017679 pacid=23155505 polypeptide=Lus10017679 locus=Lus10017679.g ID=Lus10017679.BGIv1.0 annot-version=v1.0
MGAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVT
FENVERWLKELRDHTDANIVIMLVGNKADLRHLRAVQTEDSKAFAERENTYFMETSALESLNVENAFTEVLSQIYRVVSRKALDVGDDPAALPKGQTINV
GKDDVSAVKKVGCCSA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60860 AtRABA1f RAB GTPase homolog A1F (.1) Lus10017679 0 1
AT2G27030 CAM5, CAM2, ACA... calmodulin 5 (.1.2.3) Lus10038981 1.7 0.8906
AT5G18900 2-oxoglutarate (2OG) and Fe(II... Lus10012014 1.7 0.8621
AT5G47200 AtRABD2b, AtRab... ARABIDOPSIS RAB GTPASE HOMOLOG... Lus10010999 5.5 0.8657
AT1G72510 Protein of unknown function (D... Lus10008118 7.2 0.8479
AT2G41150 unknown protein Lus10022403 7.7 0.8471
AT3G22190 IQD5 IQ-domain 5 (.1.2) Lus10013362 8.1 0.8396
AT4G17420 Tryptophan RNA-binding attenua... Lus10007800 12.2 0.7661
AT5G38660 APE1 acclimation of photosynthesis ... Lus10003077 18.6 0.8153
AT1G06620 2-oxoglutarate (2OG) and Fe(II... Lus10022197 19.9 0.7847
AT3G56740 Ubiquitin-associated (UBA) pro... Lus10038976 20.2 0.8246

Lus10017679 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.