Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G28480 73 / 5e-18 roxy19, GRX480 Thioredoxin superfamily protein (.1) AT1G03850 55 / 5e-11 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2) AT4G15700 50 / 1e-09 Thioredoxin superfamily protein (.1) AT4G15670 50 / 1e-09 Thioredoxin superfamily protein (.1) AT4G15690 49 / 4e-09 Thioredoxin superfamily protein (.1) AT4G15680 49 / 5e-09 Thioredoxin superfamily protein (.1) AT4G15660 48 / 9e-09 Thioredoxin superfamily protein (.1) AT5G18600 48 / 1e-08 Thioredoxin superfamily protein (.1) AT3G21460 46 / 8e-08 Glutaredoxin family protein (.1) AT5G14070 46 / 1e-07 ROXY2 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033649 [exp] 108 / 1e-32 AT1G28480 100 / 5e-29 Thioredoxin superfamily protein (.1) Lus10039867 [exp] 97 / 2e-27 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1) Lus10018631 [exp] 92 / 1e-25 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1) Lus10013962 [exp] 76 / 2e-19 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1) Lus10041538 [exp] 57 / 7e-12 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1) Lus10035183 [exp] 57 / 9e-12 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1) Lus10011333 [exp] 52 / 1e-09 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10038514 [exp] 50 / 3e-09 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1) Lus10023295 [exp] 48 / 2e-08 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G049800 [exp] 76 / 4e-19 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1) Potri.017G017300 [exp] 75 / 1e-18 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1) Potri.007G134800 [exp] 72 / 2e-17 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1) Potri.011G058800 [exp] 66 / 2e-15 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1) Potri.001G060600 [exp] 63 / 3e-14 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 62 / 6e-14 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 61 / 1e-13 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 49 / 4e-09 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.008G214500 [exp] 47 / 3e-08 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1) Potri.014G134000 [exp] 45 / 2e-07 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10017693 pacid=23155453 polypeptide=Lus10017693 locus=Lus10017693.g ID=Lus10017693.BGIv1.0 annot-version=v1.0 ATGACCCACGTCATCAAGCGGCTGCTTCTCTGTTTGGGAGTCAACCCGCCGGTTTTCGAGGTCGACGGAGATGACGAGGGGAAGGTTTTGAAGGAGCTGC AGGCGGTGGCGGAGGTGGTGCAGTTGCCGGCGGTTTTCGTTGGTGGGAAGTTGTTGGGTGGGTTAGATAAGGTTGTGGCCGCTCATATAACCGGTGAATT GGTTCCGATTCTGAAACAAGCTGGAGCCTTGTGGCTATGA
AA sequence Show only first row Show all	>Lus10017693 pacid=23155453 polypeptide=Lus10017693 locus=Lus10017693.g ID=Lus10017693.BGIv1.0 annot-version=v1.0 MTHVIKRLLLCLGVNPPVFEVDGDDEGKVLKELQAVAEVVQLPAVFVGGKLLGGLDKVVAAHITGELVPILKQAGALWL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10017693 [exp]	0	1
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10016323 [exp]	1.0	0.9452
AT5G24130			unknown protein		Lus10039333 [exp]	4.0	0.8631
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10000453 [exp]	4.2	0.8970
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10012978 [exp]	4.5	0.8875
AT1G33720		CYP76C6	"cytochrome P450, family 76, s...		Lus10006323 [exp]	4.5	0.8498
AT5G48540			receptor-like protein kinase-r...		Lus10038227 [exp]	4.9	0.8986
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10003940 [exp]	5.3	0.8738
					Lus10028146 [exp]	5.7	0.8192
AT2G31880		SOBIR1, EVR	SUPPRESSOR OF BIR1 1, EVERSHED...		Lus10013675 [exp]	6.2	0.8328
AT3G57120			Protein kinase superfamily pro...		Lus10029720 [exp]	6.9	0.8821

Compare expression of checked genes

Lus10017693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.