Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35160 35 / 0.001 O-methyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017691 [exp] 132 / 4e-39 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1) Lus10033647 [exp] 92 / 6e-26 AT1G51990 53 / 7e-09 O-methyltransferase family protein (.1.2) Lus10033656 [exp] 67 / 5e-15 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1) Lus10017699 [exp] 67 / 5e-15 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1) Lus10018629 [exp] 67 / 9e-15 AT4G35160 214 / 3e-66 O-methyltransferase family protein (.1) Lus10018628 [exp] 66 / 2e-14 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1) Lus10001510 [exp] 62 / 3e-13 AT4G35160 197 / 1e-59 O-methyltransferase family protein (.1) Lus10015311 [exp] 61 / 7e-13 AT4G35160 189 / 1e-56 O-methyltransferase family protein (.1) Lus10008538 [exp] 59 / 4e-12 AT4G35160 167 / 5e-48 O-methyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G093200 [exp] 67 / 2e-16 AT4G35160 78 / 4e-18 O-methyltransferase family protein (.1) Potri.013G120800 [exp] 71 / 3e-16 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1) Potri.019G093100 [exp] 70 / 6e-16 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1) Potri.013G121900 [exp] 69 / 1e-15 AT4G35160 184 / 5e-55 O-methyltransferase family protein (.1) Potri.013G122400 [exp] 67 / 6e-15 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1) Potri.019G093000 [exp] 67 / 6e-15 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1) Potri.013G121800 [exp] 66 / 8e-15 AT4G35160 158 / 7e-46 O-methyltransferase family protein (.1) Potri.013G121300 [exp] 66 / 1e-14 AT4G35160 201 / 4e-61 O-methyltransferase family protein (.1) Potri.004G050500 [exp] 65 / 3e-14 AT4G35160 178 / 2e-52 O-methyltransferase family protein (.1) Potri.013G121400 [exp] 65 / 3e-14 AT4G35160 202 / 8e-62 O-methyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF00891 [flax] [poplar] Methyltransf_2 O-methyltransferase domain
Representative CDS sequence Show only first row Show all	>Lus10017698 pacid=23155546 polypeptide=Lus10017698 locus=Lus10017698.g ID=Lus10017698.BGIv1.0 annot-version=v1.0 ATGGTGGTGGATGATGAAAGTTCGGACGTCGAATCGACGACGACACAATACTGTCTGGACATCGGGATGCTGGTAGCTCAAAAGGGGCAGGAGAGGAATA AAGAGCAATGGGAGAAGCTATTCGCCGATGCTGGATTCAGTAGATACTACATCAACCCGATTCTTAGGACGATAGCTCTCATCGAGATCTATCCCTAG
AA sequence Show only first row Show all	>Lus10017698 pacid=23155546 polypeptide=Lus10017698 locus=Lus10017698.g ID=Lus10017698.BGIv1.0 annot-version=v1.0 MVVDDESSDVESTTTQYCLDIGMLVAQKGQERNKEQWEKLFADAGFSRYYINPILRTIALIEIYP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017698 [exp]	0	1
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10013916 [exp]	1.0	0.9591
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10006160 [exp]	2.0	0.8893
AT5G44960			F-box/RNI-like/FBD-like domain...		Lus10015246 [exp]	2.0	0.9402
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Lus10039945 [exp]	2.2	0.8796
AT5G64300		ATGCH, ATRIBA1,...	RED FLUORESCENT IN DARKNESS 1,...		Lus10006669 [exp]	3.9	0.9091
					Lus10002344 [exp]	5.5	0.8702
					Lus10012943 [exp]	6.7	0.8196
AT5G52260	MYB	ATMYB19	myb domain protein 19 (.1)		Lus10027456 [exp]	6.9	0.8491
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10013130 [exp]	7.9	0.8583
AT5G60490		FLA12	FASCICLIN-like arabinogalactan...		Lus10007404 [exp]	8.9	0.8161

Compare expression of checked genes

Lus10017698 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.