Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44265 54 / 1e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51600 49 / 2e-08 LTP5 lipid transfer protein 5 (.1) AT4G28395 50 / 3e-08 ATA7 ARABIDOPSIS THALIANA ANTHER 7, ANTHER 7, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G59310 48 / 9e-08 LTP4 lipid transfer protein 4 (.1) AT5G59320 47 / 1e-07 LTP3 lipid transfer protein 3 (.1) AT2G38540 47 / 2e-07 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51590 46 / 5e-07 LTP12 lipid transfer protein 12 (.1) AT4G33355 39 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033667 [exp] 251 / 2e-87 AT5G44265 52 / 2e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10012392 [exp] 60 / 5e-12 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10015278 [exp] 52 / 3e-09 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10015279 [exp] 49 / 3e-08 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10028003 [exp] 48 / 9e-08 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10028002 [exp] 48 / 9e-08 AT5G59310 64 / 3e-14 lipid transfer protein 4 (.1) Lus10012383 [exp] 48 / 1e-07 AT5G59310 64 / 4e-14 lipid transfer protein 4 (.1) Lus10028055 [exp] 45 / 2e-06 AT5G59310 66 / 9e-15 lipid transfer protein 4 (.1) Lus10012384 [exp] 44 / 3e-06 AT5G59310 76 / 4e-19 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G012300 [exp] 67 / 6e-15 AT5G44265 68 / 1e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.007G138500 [exp] 50 / 1e-08 AT5G44265 77 / 4e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086500 [exp] 50 / 2e-08 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 50 / 2e-08 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.017G013200 [exp] 47 / 1e-07 AT5G44265 106 / 1e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135400 [exp] 47 / 2e-07 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.001G232700 [exp] 43 / 7e-06 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 43 / 8e-06 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G108100 [exp] 41 / 4e-05 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.014G046500 [exp] 40 / 6e-05 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017710 pacid=23155545 polypeptide=Lus10017710 locus=Lus10017710.g ID=Lus10017710.BGIv1.0 annot-version=v1.0 ATGGCTACCAAACTACACCTAGCAGCAACTCTAACCATTGCTCTCATGTTCATCTTCAGATCACCGTCATCACTAACAGTAACGGCTCGACGAGAAACGT ACTGCTCGAGCGTGTTCCGCGACTTCGTCCAGTGTGTCCCTTACATTTCGGGGATGTCGGTTTCTCCCACGGCCTGCTGCGTGGCCATCAATGCCTTGAA CTACAAGGCACACAAGGACGAGGACGGTCCGAAGTTGATATGCCAGTGCATCGAGGACATGGCGTACGTGATGAACATCCGGTTCATCGAGTCAAGGGTT GCCTCGCTCAATGAGGAGAGGTGCCACGTGTCGAAGAGCTTCCCGATCTCGAACAGCATGAATTGCTCCAAGTGTGGCTGGCATTTGATTAGATACATCC TTTGGCTCGACGAATTGCTCAACCTTGAGGTCGTCCAGTAA
AA sequence Show only first row Show all	>Lus10017710 pacid=23155545 polypeptide=Lus10017710 locus=Lus10017710.g ID=Lus10017710.BGIv1.0 annot-version=v1.0 MATKLHLAATLTIALMFIFRSPSSLTVTARRETYCSSVFRDFVQCVPYISGMSVSPTACCVAINALNYKAHKDEDGPKLICQCIEDMAYVMNIRFIESRV ASLNEERCHVSKSFPISNSMNCSKCGWHLIRYILWLDELLNLEVVQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44265			Bifunctional inhibitor/lipid-t...		Lus10017710 [exp]	0	1
AT2G37460			nodulin MtN21 /EamA-like trans...		Lus10007696 [exp]	7.1	0.8670
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036942 [exp]	7.3	0.8820
AT4G14060			Polyketide cyclase/dehydrase a...		Lus10008932 [exp]	16.2	0.8634
AT1G54730			Major facilitator superfamily ...		Lus10002258 [exp]	17.5	0.8636
AT4G25560	MYB	LAF1, ATMYB18	LONG AFTER FAR-RED LIGHT 1, my...		Lus10039213 [exp]	20.2	0.8153
AT5G28010			Polyketide cyclase/dehydrase a...		Lus10008930 [exp]	22.4	0.8485
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10026496 [exp]	24.7	0.8418
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10019926 [exp]	29.4	0.8561
AT5G37990			S-adenosyl-L-methionine-depend...		Lus10028500 [exp]	33.3	0.8417
AT4G35160			O-methyltransferase family pro...		Lus10023987 [exp]	34.1	0.8419

Compare expression of checked genes

Lus10017710 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.