Lus10017713 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28380 183 / 4e-56 Leucine-rich repeat (LRR) family protein (.1)
AT3G24480 129 / 5e-35 Leucine-rich repeat (LRR) family protein (.1)
AT2G15880 127 / 8e-34 Leucine-rich repeat (LRR) family protein (.1)
AT3G22800 123 / 7e-33 Leucine-rich repeat (LRR) family protein (.1)
AT4G13340 122 / 4e-32 LRX3 leucine-rich repeat/extensin 3, Leucine-rich repeat (LRR) family protein (.1)
AT4G33970 119 / 5e-31 Leucine-rich repeat (LRR) family protein (.1)
AT3G19020 119 / 1e-30 Leucine-rich repeat (LRR) family protein (.1)
AT1G49490 118 / 1e-30 Leucine-rich repeat (LRR) family protein (.1)
AT4G18670 118 / 2e-30 Leucine-rich repeat (LRR) family protein (.1)
AT5G25550 115 / 4e-30 Leucine-rich repeat (LRR) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033672 281 / 4e-94 AT4G28380 488 / 6e-173 Leucine-rich repeat (LRR) family protein (.1)
Lus10012047 139 / 1e-37 AT3G19020 508 / 6e-172 Leucine-rich repeat (LRR) family protein (.1)
Lus10027935 137 / 6e-37 AT1G49490 538 / 6e-180 Leucine-rich repeat (LRR) family protein (.1)
Lus10021001 132 / 1e-35 AT3G19020 490 / 1e-165 Leucine-rich repeat (LRR) family protein (.1)
Lus10017727 128 / 6e-34 AT3G24480 611 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Lus10006611 125 / 9e-34 AT3G22800 434 / 3e-150 Leucine-rich repeat (LRR) family protein (.1)
Lus10037905 124 / 4e-33 AT4G13340 432 / 9e-149 leucine-rich repeat/extensin 3, Leucine-rich repeat (LRR) family protein (.1)
Lus10039362 121 / 2e-32 AT3G22800 416 / 2e-143 Leucine-rich repeat (LRR) family protein (.1)
Lus10039363 120 / 4e-31 AT3G22800 447 / 1e-152 Leucine-rich repeat (LRR) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G139200 208 / 1e-65 AT4G28380 503 / 9e-179 Leucine-rich repeat (LRR) family protein (.1)
Potri.018G075900 136 / 9e-37 AT3G24480 603 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.014G036700 134 / 3e-36 AT2G15880 502 / 1e-170 Leucine-rich repeat (LRR) family protein (.1)
Potri.010G083100 130 / 6e-36 AT3G22800 447 / 2e-156 Leucine-rich repeat (LRR) family protein (.1)
Potri.006G158814 132 / 1e-35 AT3G24480 614 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.006G245600 128 / 3e-34 AT3G24480 516 / 3e-180 Leucine-rich repeat (LRR) family protein (.1)
Potri.018G035100 126 / 2e-33 AT3G24480 483 / 4e-166 Leucine-rich repeat (LRR) family protein (.1)
Potri.004G146350 126 / 3e-33 AT2G15880 600 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.009G108100 126 / 4e-33 AT3G19020 567 / 0.0 Leucine-rich repeat (LRR) family protein (.1)
Potri.010G083000 122 / 2e-32 AT3G22800 477 / 7e-167 Leucine-rich repeat (LRR) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0022 LRR PF00560 LRR_1 Leucine Rich Repeat
Representative CDS sequence
>Lus10017713 pacid=23155488 polypeptide=Lus10017713 locus=Lus10017713.g ID=Lus10017713.BGIv1.0 annot-version=v1.0
ATGGGTTGTCCCCATCCTCCTCTTCCTCCTATCCTACCCAGTATTGAAAATCGAATTGGTGAGATTTACAGTTCAAAAGATCGGTACAACGAGTTTGAAG
GAGCATTGCCTCCCCAGCTCTTCCAGACGGGGCTCGACGCGATTTTTGTCAACAACAACCGCTTCACAATCTCCAGTGCTCTCAACGGAACAGCCGGGAC
ATCAGTCTTGGTCATTGCCAACAACAAGTTCGATGGTTGCTTGCCTCACACGATATCCAACTTGGCAGAGTCTCTCGAGGAGCTAGTGCTCGTAAACTCG
AGCTTGTCCGGATGCTTGCCTCCGGAGGTAGGCTATCTATACAAGCTGAAGCTCCTTGATGTCAGCAACAACAAGCTGGTTGGTCCATTGCCATATAGCC
TAGCCGGGTTGGCTCATTTGGAGGTGCTGAATTTGGAGCATAACTTGATGACTGGGATTGTCCCTGAAGAAGTGTTCGACGATCGGAGAAACTGTCTTCC
TGATAAGCCACTTCAGAGGAGCAAGGAGCTTTGTAGCATCGTTGCGGAGCATCCTGTGGACTGCTTCCAACGATGTGGCGAGGTAGGGGGTGACATGTTT
GGTGGCATCAATAGTGGTGGTCTACTTGTTCCTGCAGCTGCTCCTGCTTTAACTCTTAGCCCTGTTTAA
AA sequence
>Lus10017713 pacid=23155488 polypeptide=Lus10017713 locus=Lus10017713.g ID=Lus10017713.BGIv1.0 annot-version=v1.0
MGCPHPPLPPILPSIENRIGEIYSSKDRYNEFEGALPPQLFQTGLDAIFVNNNRFTISSALNGTAGTSVLVIANNKFDGCLPHTISNLAESLEELVLVNS
SLSGCLPPEVGYLYKLKLLDVSNNKLVGPLPYSLAGLAHLEVLNLEHNLMTGIVPEEVFDDRRNCLPDKPLQRSKELCSIVAEHPVDCFQRCGEVGGDMF
GGINSGGLLVPAAAPALTLSPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28380 Leucine-rich repeat (LRR) fami... Lus10017713 0 1
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Lus10042371 2.6 0.9406
AT1G54520 unknown protein Lus10006109 4.6 0.9185
AT2G40190 LEW3 LEAF WILTING 3, UDP-Glycosyltr... Lus10021233 4.9 0.9242
AT5G01930 MAN6, AtMAN6 endo-beta-mannase 6, Glycosyl ... Lus10022729 4.9 0.9353
AT5G07830 ATGUS2 glucuronidase 2 (.1) Lus10036963 6.1 0.8619
AT4G23310 CRK23 cysteine-rich RLK (RECEPTOR-li... Lus10023335 6.7 0.9220
AT1G54790 GDSL-like Lipase/Acylhydrolase... Lus10029981 6.9 0.9273
AT2G21910 CYP96A5 "cytochrome P450, family 96, s... Lus10018158 8.3 0.8833
AT5G65165 SDH2-3 succinate dehydrogenase 2-3 (.... Lus10028289 9.4 0.9035
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10040226 10.0 0.9071

Lus10017713 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.