Lus10017719 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24060 157 / 3e-50 Plant self-incompatibility protein S1 family (.1)
AT3G24065 44 / 3e-06 Plant self-incompatibility protein S1 family (.1)
AT1G26798 40 / 0.0001 Plant self-incompatibility protein S1 family (.1)
AT1G26799 40 / 0.0001 Plant self-incompatibility protein S1 family (.1)
AT5G06020 39 / 0.0003 Plant self-incompatibility protein S1 family (.1)
AT3G24068 37 / 0.0009 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023675 190 / 3e-63 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1)
Lus10011754 174 / 2e-57 AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1)
Lus10033675 119 / 2e-35 AT3G24060 72 / 4e-17 Plant self-incompatibility protein S1 family (.1)
Lus10030565 47 / 3e-07 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1)
Lus10029375 38 / 0.0006 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1)
Lus10021633 38 / 0.0007 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G175200 175 / 2e-57 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053100 174 / 5e-57 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 65 / 5e-14 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 54 / 1e-09 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 53 / 2e-09 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.001G053200 50 / 1e-08 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1)
Potri.003G175100 46 / 6e-07 ND /
Potri.002G263900 43 / 6e-06 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 42 / 2e-05 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.003G175000 40 / 8e-05 AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10017719 pacid=23155510 polypeptide=Lus10017719 locus=Lus10017719.g ID=Lus10017719.BGIv1.0 annot-version=v1.0
ATGGCAGCTCTTGTAATCCTGCTGCTGTCAGCCTGGAACCAATCGGAGGATTCCATATGGACAGAGCAGGAGTACGATGTCCGAGTGATTAACGGATTCA
GGGACAACTCGTCTCTTCCACTGGTCATATGGTGCTCTTCTTCCTCGAAGGACGACGAGCACGTCGATCTCGGAGGGAGAGCGCTTCAGGAAGGCGACGA
TTTCGGGTGGATCCTGAGGACCAGGTTCTGGGACAGCAGCAGCGTCAGGGTCCTGTGCACGATGAAGTGGGATGGGAAGAGGAGGAAGTTCGAGGCGTTT
AAGGTTCCGAGGGATCTAAGGAGGTGTAATCCGACGAGGAAGTGCTCTTGGTTGGTTAGGGAGGATGGGTTCTATTTCAGCAGCGATGAGGTTAACTGGA
AGAAAGACTTCTCTTGGGATTCTTAG
AA sequence
>Lus10017719 pacid=23155510 polypeptide=Lus10017719 locus=Lus10017719.g ID=Lus10017719.BGIv1.0 annot-version=v1.0
MAALVILLLSAWNQSEDSIWTEQEYDVRVINGFRDNSSLPLVIWCSSSSKDDEHVDLGGRALQEGDDFGWILRTRFWDSSSVRVLCTMKWDGKRRKFEAF
KVPRDLRRCNPTRKCSWLVREDGFYFSSDEVNWKKDFSWDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24060 Plant self-incompatibility pro... Lus10017719 0 1
AT4G10850 SWEET7, AtSWEET... Nodulin MtN3 family protein (.... Lus10023047 3.0 0.9913
AT5G12060 Plant self-incompatibility pro... Lus10023195 4.2 0.9913
AT5G17600 RING/U-box superfamily protein... Lus10008458 5.2 0.9913
AT4G35610 C2H2ZnF zinc finger (C2H2 type) family... Lus10035994 6.0 0.9898
AT5G07480 KUOX1 KAR-UP oxidoreductase 1 (.1) Lus10043000 6.7 0.9897
AT3G08710 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredo... Lus10030505 7.3 0.9889
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10023022 7.9 0.9875
AT2G26390 Serine protease inhibitor (SER... Lus10039336 8.4 0.9867
AT1G76810 eukaryotic translation initiat... Lus10023474 8.5 0.9872
AT5G54010 UDP-Glycosyltransferase superf... Lus10008453 9.0 0.9871

Lus10017719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.