Lus10017726 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19600 48 / 3e-08 SULTR3;5 sulfate transporter 3;5 (.1)
AT4G08620 37 / 0.0002 SULTR1.2, SULTR1;1 sulphate transporter 1;1 (.1)
AT4G02700 37 / 0.0003 SULTR3;2, AST77 sulfate transporter 3;2 (.1)
AT5G10180 35 / 0.0006 SULTR2;1, AST68 sulfate transporter 2;1, ARABIDOPSIS SULFATE TRANSPORTER 68, slufate transporter 2;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029616 35 / 0.0007 AT1G22150 973 / 0.0 sulfate transporter 1;3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G156038 62 / 3e-13 AT5G19600 789 / 0.0 sulfate transporter 3;5 (.1)
Potri.006G158900 62 / 3e-13 AT5G19600 789 / 0.0 sulfate transporter 3;5 (.1)
Potri.002G049500 38 / 8e-05 AT3G51895 1028 / 0.0 sulfate transporter 3;1 (.1)
Potri.002G092400 37 / 0.0002 AT1G77990 826 / 0.0 SULPHATE TRANSPORTER 2;2, STAS domain / Sulfate transporter family (.1)
Potri.001G179400 35 / 0.0007 AT3G15990 990 / 0.0 sulfate transporter 3;4 (.1)
PFAM info
Representative CDS sequence
>Lus10017726 pacid=23176353 polypeptide=Lus10017726 locus=Lus10017726.g ID=Lus10017726.BGIv1.0 annot-version=v1.0
ATGGCATTCGTGAATCCAAGACTTGGGGTAATGGAGAAGTTGATCAAGTCTCAATTTGTGGACAAAGTCGGGAAGAAGTCTATTTTCTTGAGCATTGAGG
ATGCAATTGAGGGTATTTATGTATTGAGGAATAAAAACCAAGAGCAACCTCAGCAATCTGAGGAAGTTTAG
AA sequence
>Lus10017726 pacid=23176353 polypeptide=Lus10017726 locus=Lus10017726.g ID=Lus10017726.BGIv1.0 annot-version=v1.0
MAFVNPRLGVMEKLIKSQFVDKVGKKSIFLSIEDAIEGIYVLRNKNQEQPQQSEEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G19600 SULTR3;5 sulfate transporter 3;5 (.1) Lus10017726 0 1
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000558 3.6 1.0000
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10004067 5.1 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10005482 6.2 1.0000
Lus10011636 7.2 1.0000
AT3G16970 Plant self-incompatibility pro... Lus10011753 8.1 1.0000
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10011892 8.8 1.0000
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10022473 9.5 1.0000
AT4G10950 SGNH hydrolase-type esterase s... Lus10023070 10.2 1.0000
AT1G34575 FAD-binding Berberine family p... Lus10023373 10.8 1.0000
AT2G02340 ATPP2-B8 phloem protein 2-B8 (.1) Lus10025662 11.4 1.0000

Lus10017726 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.