Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24450 129 / 4e-39 Heavy metal transport/detoxification superfamily protein (.1) AT5G02600 85 / 3e-20 NPCC6, NAKR1 nuclear-enriched phloem companion cell gene 6, SODIUM POTASSIUM ROOT DEFECTIVE 1, Heavy metal transport/detoxification superfamily protein (.1.2) AT2G37390 79 / 3e-18 NAKR2 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) AT3G53530 76 / 3e-17 NAKR3 SODIUM POTASSIUM ROOT DEFECTIVE 3, Chloroplast-targeted copper chaperone protein (.1.2) AT2G28660 76 / 4e-17 Chloroplast-targeted copper chaperone protein (.1) AT5G27690 67 / 1e-13 Heavy metal transport/detoxification superfamily protein (.1) AT1G66240 62 / 4e-13 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.2.3) AT3G56240 56 / 8e-11 ATX1, CCH copper chaperone (.1) AT3G06130 58 / 1e-10 Heavy metal transport/detoxification superfamily protein (.1.2) AT2G18196 57 / 1e-10 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024435 [exp] 83 / 2e-19 AT2G37390 144 / 2e-41 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10025294 [exp] 81 / 1e-18 AT2G37390 141 / 3e-40 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Lus10040870 [exp] 71 / 3e-15 AT2G28660 110 / 2e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10005875 [exp] 71 / 7e-15 AT2G28660 109 / 4e-28 Chloroplast-targeted copper chaperone protein (.1) Lus10043444 [exp] 59 / 6e-12 AT1G66240 127 / 4e-39 homolog of anti-oxidant 1 (.1.2.3) Lus10031495 [exp] 61 / 2e-11 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10028859 [exp] 59 / 2e-11 AT1G66240 125 / 8e-38 homolog of anti-oxidant 1 (.1.2.3) Lus10015174 [exp] 59 / 1e-10 AT5G27690 124 / 2e-32 Heavy metal transport/detoxification superfamily protein (.1) Lus10041228 [exp] 57 / 4e-10 AT3G06130 149 / 3e-41 Heavy metal transport/detoxification superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G076400 [exp] 139 / 4e-43 AT3G24450 151 / 4e-48 Heavy metal transport/detoxification superfamily protein (.1) Potri.001G234700 [exp] 83 / 9e-20 AT2G37390 114 / 2e-30 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.016G080400 [exp] 79 / 4e-18 AT2G37390 133 / 2e-37 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.006G213900 [exp] 78 / 7e-18 AT2G37390 127 / 2e-35 SODIUM POTASSIUM ROOT DEFECTIVE 2, Chloroplast-targeted copper chaperone protein (.1.2) Potri.008G023800 [exp] 61 / 8e-13 AT1G66240 124 / 7e-39 homolog of anti-oxidant 1 (.1.2.3) Potri.010G236500 [exp] 60 / 1e-12 AT1G66240 129 / 1e-40 homolog of anti-oxidant 1 (.1.2.3) Potri.010G024700 [exp] 60 / 3e-11 AT5G27690 114 / 2e-29 Heavy metal transport/detoxification superfamily protein (.1) Potri.008G202800 [exp] 59 / 1e-10 AT3G06130 150 / 6e-41 Heavy metal transport/detoxification superfamily protein (.1.2) Potri.010G114300 [exp] 57 / 5e-10 AT1G23000 128 / 2e-33 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 55 / 5e-10 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [flax] [poplar] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Lus10017730 pacid=23176325 polypeptide=Lus10017730 locus=Lus10017730.g ID=Lus10017730.BGIv1.0 annot-version=v1.0 ATGGAGAAGCTGCAGATGAGTTTTGGGAAAGTGTTCGACAGGCTGTGTCTGTCTCCATCATCATCATCATCATCATCGTCATCAAATTCAAAATCCAACT GCTTGTGCTTCAACTACCAGCTGGAAGTTGATGAAGAAGAAGGCCAAAAGGAGTCACTAATGGTGGCAACTAGTGAGAAAAGCAGCCAAGTTGTGAGACT CAAAGATGCTATTTCTGCTAATAATAATCACACTCACACTCTCGCTTATCAACTCAAGCCTAAGATGGTAGTTCTGAGGGTATCCATGCATTGCAGCGGC TGTGCCAGGAAGGTTGAGAAACATGTTTCCAAGATTGATGGAGTGAGGTCATACAAGGTAGACCTGGAAAGCAAGAGAGTGGTTGTGATCGGAGACATTC TTCCTTACGAAGTGTTGCACAGCGTATGCAAGGTCAACAAGAATGCTCAGCTTTGGATTTGA
AA sequence Show only first row Show all	>Lus10017730 pacid=23176325 polypeptide=Lus10017730 locus=Lus10017730.g ID=Lus10017730.BGIv1.0 annot-version=v1.0 MEKLQMSFGKVFDRLCLSPSSSSSSSSSNSKSNCLCFNYQLEVDEEEGQKESLMVATSEKSSQVVRLKDAISANNNHTHTLAYQLKPKMVVLRVSMHCSG CARKVEKHVSKIDGVRSYKVDLESKRVVVIGDILPYEVLHSVCKVNKNAQLWI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24450			Heavy metal transport/detoxifi...		Lus10017730 [exp]	0	1
AT1G64640		AtENODL8	early nodulin-like protein 8 (...		Lus10033227 [exp]	3.2	0.9710
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Lus10018766 [exp]	3.7	0.9703
AT5G15140			Galactose mutarotase-like supe...		Lus10005251 [exp]	4.9	0.9656
					Lus10024349 [exp]	5.9	0.9654
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10018765 [exp]	6.0	0.9644
AT3G04730	AUX_IAA	IAA16	indoleacetic acid-induced prot...		Lus10024854 [exp]	6.5	0.9644
AT2G03350			Protein of unknown function, D...		Lus10036804 [exp]	6.9	0.9675
AT2G39180		CCR2, ATCRR2	CRINKLY4 related 2 (.1)		Lus10036524 [exp]	7.9	0.9641
AT3G07010			Pectin lyase-like superfamily ...		Lus10011885 [exp]	10.4	0.9606
AT1G47740			PPPDE putative thiol peptidase...		Lus10011291 [exp]	11.3	0.9538

Compare expression of checked genes

Lus10017730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.