Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G44290 103 / 2e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 100 / 2e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 92 / 4e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT3G58550 87 / 1e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G27950 73 / 5e-16 LTPG1 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) AT1G73890 67 / 7e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 64 / 1e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 63 / 2e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 62 / 5e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 54 / 4e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033076 [exp] 260 / 5e-89 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 110 / 4e-28 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10042449 [exp] 94 / 1e-23 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026220 [exp] 79 / 2e-17 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10037027 [exp] 74 / 2e-16 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10006413 [exp] 73 / 6e-16 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10015779 [exp] 72 / 1e-15 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10042984 [exp] 67 / 1e-13 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032488 [exp] 66 / 3e-13 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G232000 [exp] 114 / 9e-32 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G195700 [exp] 95 / 2e-24 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G008500 [exp] 95 / 2e-24 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G217000 [exp] 94 / 3e-24 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G172400 [exp] 82 / 1e-19 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.001G056200 [exp] 71 / 2e-15 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.015G054000 [exp] 62 / 5e-12 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 62 / 5e-12 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 57 / 3e-10 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.008G155100 [exp] 56 / 5e-10 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10017749 pacid=23176354 polypeptide=Lus10017749 locus=Lus10017749.g ID=Lus10017749.BGIv1.0 annot-version=v1.0 ATGTCCAAAAAAGAGTTAGTTGGTGTCCTCATCATGGCCTTCTTGGCAATAGCTGCAACAGCAACGTTGCAGGAAGACGAGGCAGAATGCGCAGAGCACC TTGCAGATCTTGCGGCTTGCATTCCATTTGTGAGTGGCACCGCCAAGAAGCCAACAACTGAGTGCTGTCAAGACGCCAAGAAACTGAAAGCCACCGAGCC TAAGTGCTTGTGTGTCCTCATCATTGCGAGCACAGACCCTTCCATGGGTCTCCCTGTCAACACCACCCTCGCCCTTCAAATGCCTTCTGCCTGCAATATA GATGATGCCAAAGCCTCTAACTGTCCCTCTCTCTTGAACATTTCTCCAGACTCCCCAGATGCAAAGGTCTTCAAAGAAGCAGGAATTTCAGATTCTTCTT CCACCAGTGGCTCAAGCACAGCAACTGGTTCCCCACCAAATTCTGCTTCTCCATCATCAGGCTCATCTTCTTCTTCATCTTCCACTCCAACTGATTCCAG CTCAAAAACTGATTCAAAAGCTTCTCCAAACAGCAGTAATGGCCAAAAGATGAAGGTTTTCGGAGCATGGATGTTGATGGCTCTTGCAGCTGGGGTGTTC TTCTGA
AA sequence Show only first row Show all	>Lus10017749 pacid=23176354 polypeptide=Lus10017749 locus=Lus10017749.g ID=Lus10017749.BGIv1.0 annot-version=v1.0 MSKKELVGVLIMAFLAIAATATLQEDEAECAEHLADLAACIPFVSGTAKKPTTECCQDAKKLKATEPKCLCVLIIASTDPSMGLPVNTTLALQMPSACNI DDAKASNCPSLLNISPDSPDAKVFKEAGISDSSSTSGSSTATGSPPNSASPSSGSSSSSSSTPTDSSSKTDSKASPNSSNGQKMKVFGAWMLMALAAGVF F

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G44290			Bifunctional inhibitor/lipid-t...		Lus10017749 [exp]	0	1
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10001010 [exp]	1.7	0.9312
AT5G58050		GDPDL6, SVL4	Glycerophosphodiester phosphod...		Lus10000055 [exp]	2.0	0.9047
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10016715 [exp]	2.8	0.9197
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10028397 [exp]	4.2	0.9072
AT1G09157			Protein of unknown function (D...		Lus10030466 [exp]	4.5	0.8532
AT5G08560			transducin family protein / WD...		Lus10001412 [exp]	7.1	0.8564
AT2G34930			disease resistance family prot...		Lus10029483 [exp]	7.3	0.8408
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10028201 [exp]	8.1	0.8914
AT3G51070			S-adenosyl-L-methionine-depend...		Lus10028354 [exp]	9.5	0.8816
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Lus10014175 [exp]	9.9	0.8744

Compare expression of checked genes

Lus10017749 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.