Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18660 36 / 0.0006 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033054 [exp] 111 / 3e-33 AT2G18660 56 / 1e-10 plant natriuretic peptide A (.1) Lus10019444 [exp] 110 / 1e-32 AT2G18660 68 / 3e-15 plant natriuretic peptide A (.1) Lus10013118 [exp] 84 / 2e-22 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1) Lus10026232 [exp] 50 / 7e-09 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1) Lus10030078 [exp] 49 / 1e-08 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1) Lus10042435 [exp] 45 / 3e-07 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1) Lus10026931 [exp] 38 / 0.0002 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G155000 [exp] 88 / 6e-24 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1) Potri.018G031901 [exp] 86 / 5e-23 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1) Potri.006G249500 [exp] 82 / 1e-21 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1) Potri.018G029100 [exp] 52 / 3e-10 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1) Potri.006G252200 [exp] 52 / 5e-10 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1) Potri.018G098200 [exp] 49 / 1e-08 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1) Potri.003G218300 [exp] 48 / 2e-08 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0199 [flax] [poplar] DPBB PF03330 [flax] [poplar] DPBB_1 Lytic transglycolase
Representative CDS sequence Show only first row Show all	>Lus10017763 pacid=23176304 polypeptide=Lus10017763 locus=Lus10017763.g ID=Lus10017763.BGIv1.0 annot-version=v1.0 ATGGGACATGGGGCAGCCTGCGGGAGGCAGTACAAAGTCAGGTGTATTAGCTCTGTCGCACGAGGTTCCTGTAAGCCTGATGAGACTATTCAGGTGAAGA TCGTCGACCGAGCTCAGACATTGGTCTCTCCGCCATCAGCCAGAGGAAACACCATTGTTCTTTCCCAGACGGCCTTCGCTATCGTCGCCAATTGGACAGC CAGTAGCGCCGTCAACATTGAGTGGCAACAGTAA
AA sequence Show only first row Show all	>Lus10017763 pacid=23176304 polypeptide=Lus10017763 locus=Lus10017763.g ID=Lus10017763.BGIv1.0 annot-version=v1.0 MGHGAACGRQYKVRCISSVARGSCKPDETIQVKIVDRAQTLVSPPSARGNTIVLSQTAFAIVANWTASSAVNIEWQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017763 [exp]	0	1
AT3G22400		ATLOX5, LOX5	Arabidopsis thaliana lipoxygen...		Lus10008041 [exp]	1.0	0.8438
					Lus10033534 [exp]	8.5	0.8429
AT1G56240		ATPP2-B13	phloem protein 2-B13 (.1)		Lus10018173 [exp]	8.7	0.5974
AT1G55790			Domain of unknown function (DU...		Lus10032899 [exp]	9.9	0.7677
					Lus10039990 [exp]	10.4	0.8429
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10038876 [exp]	12.0	0.8429
AT1G43780		SCPL44	serine carboxypeptidase-like 4...		Lus10040330 [exp]	13.4	0.8429
					Lus10022805 [exp]	14.7	0.8429
AT5G05530			RING/U-box superfamily protein...		Lus10024629 [exp]	15.9	0.8429
AT2G15220			Plant basic secretory protein ...		Lus10026579 [exp]	17.0	0.8429

Compare expression of checked genes

Lus10017763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.