Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017767 pacid=23176318 polypeptide=Lus10017767 locus=Lus10017767.g ID=Lus10017767.BGIv1.0 annot-version=v1.0 ATGCCTGTTGATAGTTCTCTCTGCAGTTTCCGAGCTCTTGAGAGTTCTTCTATTCTCCAGAAAAATCAAGAAATAGGTAGATATGGATTACATGGAGATG CATCCTCTATGAGTGAACACCAGCCTCATCAAAAACTCAATATTAGGAAGGGGAGGGGTGAATCAATCGAAGCATAG
AA sequence Show only first row Show all	>Lus10017767 pacid=23176318 polypeptide=Lus10017767 locus=Lus10017767.g ID=Lus10017767.BGIv1.0 annot-version=v1.0 MPVDSSLCSFRALESSSILQKNQEIGRYGLHGDASSMSEHQPHQKLNIRKGRGESIEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017767 [exp]	0	1
AT5G63180			Pectin lyase-like superfamily ...		Lus10006241 [exp]	2.2	0.8886
AT2G26650		AKT1, ATAKT1	K+ transporter 1, K+ transport...		Lus10017766 [exp]	2.8	0.8494
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10041381 [exp]	3.7	0.7776
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Lus10031578 [exp]	8.7	0.8212
AT1G13970			Protein of unknown function (D...		Lus10036799 [exp]	9.6	0.8342
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10019231 [exp]	12.8	0.8247
AT3G24240			Leucine-rich repeat receptor-l...		Lus10018911 [exp]	13.0	0.8138
AT5G16780		MDF, DOT2	MERISTEM-DEFECTIVE, DEFECTIVEL...		Lus10014613 [exp]	16.6	0.7799
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10006065 [exp]	18.0	0.7917
AT3G27470			Protein of unknown function (D...		Lus10035228 [exp]	19.0	0.7914

Compare expression of checked genes

Lus10017767 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.