Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52720 72 / 2e-17 unknown protein AT3G15630 71 / 9e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033048 [exp] 192 / 1e-64 AT3G15630 89 / 9e-24 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G174300 [exp] 85 / 3e-22 AT1G52720 116 / 1e-34 unknown protein Potri.003G059900 [exp] 81 / 1e-20 AT1G52720 110 / 2e-32 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017768 pacid=23176307 polypeptide=Lus10017768 locus=Lus10017768.g ID=Lus10017768.BGIv1.0 annot-version=v1.0 ATGGCTTCCAATCTCCTCAGCCTCCGTCCTTCCGTCGTCCGCCCCTACGCCGTATCCGACCCCAACCGCAGGAGGAACTCTTCCACCTCCCCCGCCTCCT CCTCTGCCAAATGGTGGTCGCCGCTCTTTGGCTGGTCCTCCGAGCCGGACTACATCGGAAATGATGGAGGATCCGATCATCAGGACAAGGATCTGAGCAG ATCCGACACGGATCTGGAGTCCAAGCTGGCGAGATCTCGATTTTCGCCAGGATGCTTCACCGTCGAGAAGGCTAAGCAGCTGAGAATGATGACGTCCGAC GCGTCGTCCCACCACGACGCCATGTACCACTCCGCTATCGCCTCTCGCCTCGCCTCCGACTTTAAGAACAACTCCTCCGGCGACCGGTAG
AA sequence Show only first row Show all	>Lus10017768 pacid=23176307 polypeptide=Lus10017768 locus=Lus10017768.g ID=Lus10017768.BGIv1.0 annot-version=v1.0 MASNLLSLRPSVVRPYAVSDPNRRRNSSTSPASSSAKWWSPLFGWSSEPDYIGNDGGSDHQDKDLSRSDTDLESKLARSRFSPGCFTVEKAKQLRMMTSD ASSHHDAMYHSAIASRLASDFKNNSSGDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15630			unknown protein		Lus10017768 [exp]	0	1
AT3G22440			FRIGIDA-like protein (.1)		Lus10006113 [exp]	2.0	0.7995
AT5G57480			P-loop containing nucleoside t...		Lus10006968 [exp]	3.0	0.7797
AT5G57480			P-loop containing nucleoside t...		Lus10006967 [exp]	6.0	0.7532
AT1G78700	BZR	BEH4	BES1/BZR1 homolog 4 (.1)		Lus10007319 [exp]	6.5	0.7606
AT3G14310		ATPME3	pectin methylesterase 3 (.1)		Lus10003933 [exp]	6.7	0.7456
AT5G66730	C2H2ZnF	IDD1, ENY	INDETERMINATE DOMAIN 1, ENHYDR...		Lus10007168 [exp]	10.5	0.7524
AT4G39100		SHL1	short life, PHD finger family ...		Lus10017482 [exp]	12.4	0.7728
AT5G61960		AML1	MEI2-like protein 1 (.1.2)		Lus10043204 [exp]	15.0	0.7916
AT4G38470		STY46	serine/threonine/tyrosine kina...		Lus10022653 [exp]	15.9	0.7362
AT2G30933			Carbohydrate-binding X8 domain...		Lus10031443 [exp]	19.8	0.7411

Compare expression of checked genes

Lus10017768 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.