Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04790 85 / 3e-21 EMB3119 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) AT2G01290 71 / 6e-16 RPI2 ribose-5-phosphate isomerase 2 (.1) AT1G71100 67 / 8e-15 RSW10 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) AT5G44520 44 / 4e-06 NagB/RpiA/CoA transferase-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015919 [exp] 103 / 3e-28 AT3G04790 390 / 4e-138 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Lus10009180 [exp] 102 / 5e-28 AT3G04790 318 / 8e-110 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Lus10032450 [exp] 69 / 2e-15 AT1G71100 362 / 3e-127 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) Lus10042951 [exp] 69 / 3e-15 AT1G71100 356 / 4e-125 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) Lus10026777 [exp] 63 / 3e-13 AT1G71100 344 / 3e-120 RADIAL SWELLING 10, Ribose 5-phosphate isomerase, type A protein (.1) Lus10036094 [exp] 61 / 3e-12 AT2G01290 342 / 2e-119 ribose-5-phosphate isomerase 2 (.1) Lus10008059 [exp] 42 / 2e-05 AT5G44520 290 / 4e-98 NagB/RpiA/CoA transferase-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G052000 [exp] 94 / 8e-25 AT3G04790 354 / 9e-124 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Potri.013G039400 [exp] 91 / 2e-23 AT3G04790 379 / 2e-133 EMBRYO DEFECTIVE 3119, Ribose 5-phosphate isomerase, type A protein (.1) Potri.001G225700 [exp] 70 / 1e-15 AT2G01290 378 / 1e-133 ribose-5-phosphate isomerase 2 (.1) Potri.010G115300 [exp] 67 / 9e-15 AT2G01290 368 / 1e-129 ribose-5-phosphate isomerase 2 (.1) Potri.008G127600 [exp] 65 / 6e-14 AT2G01290 365 / 2e-128 ribose-5-phosphate isomerase 2 (.1) Potri.011G155500 [exp] 48 / 8e-08 AT5G44520 294 / 7e-100 NagB/RpiA/CoA transferase-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0246 [flax] [poplar] ISOCOT_Fold PF06026 [flax] [poplar] Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Representative CDS sequence Show only first row Show all	>Lus10017770 pacid=23176319 polypeptide=Lus10017770 locus=Lus10017770.g ID=Lus10017770.BGIv1.0 annot-version=v1.0 ATGTGTGGTCTGGTCATCGAAAACGATGAGCAGACGACCATAATGAATGGTCTAGCGACTAGACTTCTGACTGTTCCTCAGTCTCGAAACTGGCTCCACG CTGCCTTCGTCGTTTCCAAGCTCGGAGAGCTTCTCACATCCGGCCAATTGAAAGATATGGTTGGGATCCCTACTTTTAAGCGAACTGAGGAGCAAGCTCG ATCCCTAGGGATTCCTCTCTCCATCCTCGACGATCACACAAAGCTCAACCTGGCCATCGATAGAGCAGATGAGGTCTCATGA
AA sequence Show only first row Show all	>Lus10017770 pacid=23176319 polypeptide=Lus10017770 locus=Lus10017770.g ID=Lus10017770.BGIv1.0 annot-version=v1.0 MCGLVIENDEQTTIMNGLATRLLTVPQSRNWLHAAFVVSKLGELLTSGQLKDMVGIPTFKRTEEQARSLGIPLSILDDHTKLNLAIDRADEVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G04790		EMB3119	EMBRYO DEFECTIVE 3119, Ribose ...		Lus10017770 [exp]	0	1

Compare expression of checked genes

Lus10017770 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.