Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45970 42 / 9e-06 CYP86A8, LCR LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) AT4G00360 40 / 6e-05 ATT1, CYP86A2 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) AT1G01600 37 / 0.0003 CYP86A4 "cytochrome P450, family 86, subfamily A, polypeptide 4", cytochrome P450, family 86, subfamily A, polypeptide 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018831 [exp] 110 / 3e-31 AT4G00360 403 / 8e-139 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10014768 [exp] 49 / 4e-08 AT4G00360 756 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1) Lus10036367 [exp] 45 / 2e-07 AT4G00360 87 / 2e-21 "cytochrome P450, family 86, subfamily A, polypeptide 2", ABERRANT INDUCTION OF TYPE THREE 1, cytochrome P450, family 86, subfamily A, polypeptide 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G085800 [exp] 50 / 1e-08 AT2G45970 866 / 0.0 LACERATA, "cytochrome P450, family 86, subfamily A, polypeptide 8", cytochrome P450, family 86, subfamily A, polypeptide 8 (.1) Potri.003G129100 [exp] 39 / 0.0001 AT1G63710 823 / 0.0 "cytochrome P450, family 86, subfamily A, polypeptide 7", cytochrome P450, family 86, subfamily A, polypeptide 7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017791 pacid=23177697 polypeptide=Lus10017791 locus=Lus10017791.g ID=Lus10017791.BGIv1.0 annot-version=v1.0 ATGTCGTTGACCCTGTTCATGAAACATGGGTTGATGGTCAACGTCGGGAAGCGGGACCTGGAAGAGACGGCGGCGAGAATAAGGAGAGTGGCCGGGGACG GGAATGGTAATAAAGGACAGAATGGTAATAATGCGAAGCAGCTGCCGACGGTGGGGGTGAGGTGTAATGGTGGTACGTGGGAGAGTAGTGGGAGTGGACC TGATAATCAGAGGAAGGCGATGGTAGTTGGGGTGGTTTAA
AA sequence Show only first row Show all	>Lus10017791 pacid=23177697 polypeptide=Lus10017791 locus=Lus10017791.g ID=Lus10017791.BGIv1.0 annot-version=v1.0 MSLTLFMKHGLMVNVGKRDLEETAARIRRVAGDGNGNKGQNGNNAKQLPTVGVRCNGGTWESSGSGPDNQRKAMVVGVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017791 [exp]	0	1
AT5G59530			2-oxoglutarate (2OG) and Fe(II...		Lus10022196 [exp]	2.2	0.9135
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10008266 [exp]	3.0	0.8623
AT2G45970		CYP86A8, LCR	LACERATA, "cytochrome P450, fa...		Lus10017789 [exp]	3.2	0.9085
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10034540 [exp]	5.0	0.8830
AT2G20875		EPF1	epidermal patterning factor 1 ...		Lus10018576 [exp]	5.3	0.8856
AT2G28630		KCS12	3-ketoacyl-CoA synthase 12 (.1...		Lus10040873 [exp]	5.5	0.8923
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10039366 [exp]	6.7	0.8313
AT1G68530		KCS6, CER6, POP...	POLLEN-PISTIL INCOMPATIBILITY ...		Lus10034319 [exp]	9.8	0.8776
AT3G18050			unknown protein		Lus10027253 [exp]	10.0	0.8233
AT1G25450		KCS5, CER60	ECERIFERUM 60, 3-ketoacyl-CoA ...		Lus10041452 [exp]	10.6	0.8721

Compare expression of checked genes

Lus10017791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.