Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51310 82 / 9e-20 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G23340 81 / 2e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G17020 52 / 1e-08 ATSRG1, SRG1 senescence-related gene 1 (.1) AT3G19010 51 / 1e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT1G17010 51 / 1e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G80330 50 / 3e-08 ATGA3OX4 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 4, gibberellin 3-oxidase 4 (.1) AT5G63595 50 / 3e-08 ATFLS4, FLS4 flavonol synthase 4 (.1) AT3G13610 50 / 4e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19000 49 / 8e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G25300 49 / 8e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018836 [exp] 135 / 6e-40 AT5G51310 348 / 7e-120 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10009663 [exp] 82 / 2e-19 AT4G23340 358 / 6e-124 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10009025 [exp] 79 / 6e-19 AT5G51310 131 / 9e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10011476 [exp] 53 / 4e-09 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10008100 [exp] 53 / 6e-09 AT4G21690 273 / 8e-90 ARABIDOPSIS THALIANA GIBBERELLIN 3-OXIDASE 3, gibberellin 3-oxidase 3 (.1) Lus10013135 [exp] 52 / 8e-09 AT1G15550 263 / 4e-86 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10030941 [exp] 50 / 4e-08 AT1G17010 258 / 2e-84 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030934 [exp] 50 / 6e-08 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1) Lus10006518 [exp] 49 / 1e-07 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G106900 [exp] 106 / 9e-29 AT4G23340 392 / 1e-137 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.003G128100 [exp] 103 / 7e-28 AT4G23340 458 / 2e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.002G159500 [exp] 102 / 2e-27 AT4G23340 402 / 3e-141 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G023550 [exp] 52 / 3e-09 AT3G21420 210 / 6e-68 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033600 [exp] 52 / 5e-09 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.001G378400 [exp] 52 / 1e-08 AT1G78440 404 / 1e-141 Arabidopsis thaliana gibberellin 2-oxidase 1 (.1) Potri.010G023600 [exp] 51 / 1e-08 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G057400 [exp] 51 / 2e-08 AT1G15550 451 / 2e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.009G107600 [exp] 51 / 2e-08 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G049000 [exp] 51 / 2e-08 AT2G36690 209 / 5e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017799 pacid=23177719 polypeptide=Lus10017799 locus=Lus10017799.g ID=Lus10017799.BGIv1.0 annot-version=v1.0 ATGGTGGACATATCTCAGCCGCTGAATCCATCATCACTGTTATCTCTAGCTGATGCCTGCCAGAAATGGGGATTCTTCCACATCATCAACCATGGAATCC CCAGGAATCTTTACGACAGAATCTATAACATATCTCAGCATTTCTTCAGCTTGCCTTGTCATTCGAAACTAGAGCAACTGGGTCCTCCTTCCCTTCTCCA AACTTACACTCCAAAATTCATAGCTTCCCCTTTCTTCGAGAGCCTCCGTCTCTCTGGCCCGGACTTCTTCTCCTCTGCTCACTCCTCTGCCCCTCCCTTG CTCGCCCCGCACCTCTCTTCCAAATTCAGGAAACAAGGGAGTAGACATGGATAG
AA sequence Show only first row Show all	>Lus10017799 pacid=23177719 polypeptide=Lus10017799 locus=Lus10017799.g ID=Lus10017799.BGIv1.0 annot-version=v1.0 MVDISQPLNPSSLLSLADACQKWGFFHIINHGIPRNLYDRIYNISQHFFSLPCHSKLEQLGPPSLLQTYTPKFIASPFFESLRLSGPDFFSSAHSSAPPL LAPHLSSKFRKQGSRHG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51310			2-oxoglutarate (2OG) and Fe(II...		Lus10017799 [exp]	0	1

Compare expression of checked genes

Lus10017799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.