Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042979 [exp] 142 / 1e-40 AT5G08020 54 / 5e-07 ARABIDOPSIS THALIANA RPA70-KDA SUBUNIT B, RPA70-kDa subunit B (.1) Lus10014851 [exp] 140 / 1e-40 ND 34 / 0.005 Lus10003030 [exp] 124 / 2e-37 ND / Lus10026444 [exp] 120 / 3e-33 ND / Lus10007779 [exp] 97 / 1e-26 ND / Lus10006886 [exp] 87 / 3e-21 ND / Lus10027613 [exp] 84 / 4e-20 ND / Lus10023004 [exp] 79 / 3e-19 ND / Lus10039353 [exp] 74 / 3e-16 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017800 pacid=23177706 polypeptide=Lus10017800 locus=Lus10017800.g ID=Lus10017800.BGIv1.0 annot-version=v1.0 ATGCCTCCTGAACGAAATAGAGCGTGGACTTTGGTGCGGATCATATCTTTCGATCGGAGTCCTGGCAACTTAGTTTATATCGATGGCTACTTCAGCTACT CAGTCCTCGCGCGGTGTGCGGATGCAACAGCAACAACTGACATCTTATTCACCGGAGCATCAGCATCCCTTCTGTTTCGCATGCCTCCGGATGAATACGT GACCCTGACCCATGAACAAGAAACTACACTTCTGCTTGGACTACACGGCACCATGTTTGTTCTCGAGGTTCGCCCTGTCGATCCTGGTCACATCGACCGA GCAAAGTTTGACGCTACTAATCTATGGGATCCCGTTGTTGCTTTCTACTAG
AA sequence Show only first row Show all	>Lus10017800 pacid=23177706 polypeptide=Lus10017800 locus=Lus10017800.g ID=Lus10017800.BGIv1.0 annot-version=v1.0 MPPERNRAWTLVRIISFDRSPGNLVYIDGYFSYSVLARCADATATTDILFTGASASLLFRMPPDEYVTLTHEQETTLLLGLHGTMFVLEVRPVDPGHIDR AKFDATNLWDPVVAFY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10017800 [exp]	0	1
					Lus10017801 [exp]	2.4	0.8923
AT1G75980			Single hybrid motif superfamil...		Lus10017287 [exp]	2.4	0.9156
AT2G25700		ASK3	SKP1-like 3 (.1)		Lus10043288 [exp]	3.2	0.9042
					Lus10024757 [exp]	5.5	0.8960
AT5G08370		ATAGAL2	alpha-galactosidase 2 (.1.2)		Lus10038325 [exp]	6.0	0.8973
AT5G58600		TBL44, PMR5	TRICHOME BIREFRINGENCE-LIKE 44...		Lus10031871 [exp]	7.2	0.8394
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10021709 [exp]	9.8	0.8641
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10014773 [exp]	12.4	0.8764
AT3G27030			unknown protein		Lus10041551 [exp]	12.6	0.8302
					Lus10040041 [exp]	12.8	0.9000

Compare expression of checked genes

Lus10017800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.