Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57880 140 / 2e-40 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) AT5G12970 135 / 1e-38 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) AT4G00700 134 / 3e-38 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT1G51570 133 / 7e-38 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) AT5G06850 132 / 2e-37 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT5G48060 130 / 1e-36 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT4G11610 129 / 2e-36 NTRB, ATNTRB C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT3G61300 129 / 3e-36 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT1G22610 123 / 2e-34 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) AT3G03680 112 / 1e-30 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018839 [exp] 169 / 2e-50 AT4G11610 1348 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10016280 [exp] 142 / 5e-41 AT3G57880 1499 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Lus10012026 [exp] 142 / 5e-41 AT3G57880 1496 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Lus10031244 [exp] 140 / 2e-40 AT5G12970 979 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Lus10031816 [exp] 137 / 3e-40 AT4G11610 513 / 1e-176 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10000605 [exp] 135 / 3e-38 AT4G11610 1634 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10021030 [exp] 131 / 5e-37 AT5G06850 1383 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10037479 [exp] 129 / 7e-37 AT5G48060 866 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Lus10023823 [exp] 127 / 8e-36 AT5G06850 1382 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G081700 [exp] 153 / 8e-45 AT4G11610 1422 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.002G158000 [exp] 149 / 3e-43 AT4G11610 1400 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.003G210801 [exp] 143 / 2e-41 AT5G12970 1300 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.T085601 [exp] 142 / 5e-41 AT5G12970 1315 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.006G058900 [exp] 141 / 8e-41 AT3G57880 1372 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.001G015700 [exp] 141 / 1e-40 AT5G12970 1295 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.016G049100 [exp] 140 / 2e-40 AT3G57880 1425 / 0.0 Calcium-dependent lipid-binding (CaLB domain) plant phosphoribosyltransferase family protein (.1) Potri.003G125900 [exp] 140 / 3e-40 AT4G11610 1543 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.001G105400 [exp] 140 / 4e-40 AT4G11610 1567 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1) Potri.009G065600 [exp] 135 / 2e-38 AT5G06850 1308 / 0.0 C2 calcium/lipid-binding plant phosphoribosyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0484 [flax] [poplar] Peroxisome PF08372 [flax] [poplar] PRT_C Plant phosphoribosyltransferase C-terminal
Representative CDS sequence Show only first row Show all	>Lus10017816 pacid=23177720 polypeptide=Lus10017816 locus=Lus10017816.g ID=Lus10017816.BGIv1.0 annot-version=v1.0 ATGAGGATACAGACAGTGGTAGGAGATGTGGCTAATCAAGGGGAAAGGATACAGGCACTACTGAGCTGGAGGGACCCTCGCGCCACATCGATATTTGTGA CATTCTGCCTTGTGGCTGCTGTCCTTTTGTATGGAACACCATTCCAGATTTTGGCACTTATTGGTGGTGTTTATGCAATGAGGCATCCCAGGTTCAGGCA TAAAACACCTGGTGCTCCTCTTAATTTCTTCAGACGCCTGCTGGCTACCACTGATAGTATGTTGTGA
AA sequence Show only first row Show all	>Lus10017816 pacid=23177720 polypeptide=Lus10017816 locus=Lus10017816.g ID=Lus10017816.BGIv1.0 annot-version=v1.0 MRIQTVVGDVANQGERIQALLSWRDPRATSIFVTFCLVAAVLLYGTPFQILALIGGVYAMRHPRFRHKTPGAPLNFFRRLLATTDSML

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12970			Calcium-dependent lipid-bindin...		Lus10017816 [exp]	0	1
AT4G27620			unknown protein		Lus10008948 [exp]	10.2	0.6477
AT2G03210		ATFUT2, FUT2	fucosyltransferase 2 (.1)		Lus10026125 [exp]	15.6	0.6424
AT5G13825			unknown protein		Lus10001690 [exp]	17.7	0.6464
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10000249 [exp]	20.5	0.6370
AT5G05340			Peroxidase superfamily protein...		Lus10009932 [exp]	34.9	0.6160
AT2G17480		ATMLO8, MLO8	MILDEW RESISTANCE LOCUS O 8, S...		Lus10019630 [exp]	45.0	0.5752
					Lus10022884 [exp]	54.8	0.5929
AT1G27180			disease resistance protein (TI...		Lus10040576 [exp]	65.5	0.5844
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Lus10021707 [exp]	74.7	0.5783
AT5G52020	AP2_ERF		Integrase-type DNA-binding sup...		Lus10024492 [exp]	77.0	0.5680

Compare expression of checked genes

Lus10017816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.