Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45880 156 / 5e-45 BZR BAM7, BMY4 BETA-AMYLASE 4, beta-amylase 7 (.1) AT5G45300 84 / 2e-19 BZR BAM8, BMY2 BETA-AMYLASE 8, beta-amylase 2 (.1.2) AT1G75080 54 / 4e-09 BZR BZR1 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) AT1G19350 53 / 1e-08 BZR BZR2, BES1 BRASSINAZOLE-RESISTANT 2, BRI1-EMS-SUPPRESSOR 1, Brassinosteroid signalling positive regulator (BZR1) family protein AT3G50750 50 / 8e-08 BZR BEH1 BES1/BZR1 homolog 1 (.1) AT4G36780 50 / 1e-07 BZR BEH2 BES1/BZR1 homolog 2 (.1) AT1G78700 49 / 2e-07 BZR BEH4 BES1/BZR1 homolog 4 (.1) AT4G18890 44 / 9e-06 BZR BEH3 BES1/BZR1 homolog 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018842 [exp] 226 / 1e-70 AT2G45880 879 / 0.0 BETA-AMYLASE 4, beta-amylase 7 (.1) Lus10035679 [exp] 82 / 1e-18 AT5G45300 884 / 0.0 BETA-AMYLASE 8, beta-amylase 2 (.1.2) Lus10010795 [exp] 52 / 3e-08 AT1G75080 332 / 2e-113 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Lus10016307 [exp] 52 / 4e-08 AT1G75080 392 / 5e-137 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Lus10026036 [exp] 47 / 1e-06 AT1G75080 303 / 2e-102 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Lus10014327 [exp] 47 / 2e-06 AT1G75080 309 / 1e-104 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Lus10005419 [exp] 42 / 6e-05 AT1G78700 348 / 9e-120 BES1/BZR1 homolog 4 (.1) Lus10007319 [exp] 42 / 7e-05 AT1G78700 310 / 2e-104 BES1/BZR1 homolog 4 (.1) Lus10015238 [exp] 42 / 7e-05 AT1G78700 347 / 3e-119 BES1/BZR1 homolog 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G083700 [exp] 166 / 1e-48 AT2G45880 863 / 0.0 BETA-AMYLASE 4, beta-amylase 7 (.1) Potri.002G159300 [exp] 155 / 2e-44 AT2G45880 858 / 0.0 BETA-AMYLASE 4, beta-amylase 7 (.1) Potri.001G372500 [exp] 82 / 2e-19 AT2G45880 83 / 4e-18 BETA-AMYLASE 4, beta-amylase 7 (.1) Potri.003G106500 [exp] 83 / 6e-19 AT5G45300 831 / 0.0 BETA-AMYLASE 8, beta-amylase 2 (.1.2) Potri.016G125700 [exp] 59 / 1e-11 AT1G19350 82 / 1e-18 BRASSINAZOLE-RESISTANT 2, BRI1-EMS-SUPPRESSOR 1, Brassinosteroid signalling positive regulator (BZR1) family protein Potri.014G041600 [exp] 53 / 1e-08 AT1G75080 349 / 2e-120 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Potri.002G133700 [exp] 52 / 2e-08 AT1G75080 326 / 2e-111 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Potri.005G126400 [exp] 49 / 2e-07 AT1G75080 269 / 1e-88 BRASSINAZOLE-RESISTANT 1, Brassinosteroid signalling positive regulator (BZR1) family protein (.1), Brassinosteroid signalling positive regulator (BZR1) family protein (.2) Potri.001G386900 [exp] 47 / 9e-07 AT1G78700 340 / 7e-117 BES1/BZR1 homolog 4 (.1) Potri.003G026600 [exp] 47 / 9e-07 AT1G78700 341 / 4e-117 BES1/BZR1 homolog 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05687 [flax] [poplar] BES1_N BES1/BZR1 plant transcription factor, N-terminal
Representative CDS sequence Show only first row Show all	>Lus10017819 pacid=23177703 polypeptide=Lus10017819 locus=Lus10017819.g ID=Lus10017819.BGIv1.0 annot-version=v1.0 ATGGCAACGGATATGCAAAGGCTGATAGTAACTAGTGAAGAGGAAGAAATAGACATGGACGTTAAAGAGGAAGATAACAGGGGAAAGCATATTGATGCTC AACTGATGGCTGGGATCGATGGAGGGATGCTGTCTGACAGTTGTGACAGCCAGTTTCAGTATCATCAGCAGCTTCAAGAACAAGTTAGCACCCCAGGAGG AGAGAACATAGGTCGAAGGTGTAGGCCAGTTGAAGAGAAAGAGAGGACCAAGCTTAGAGAGCGGCATCGAAGGGCAATCACTGCCAGGATCCTAGCAGGG TTAAGAAGGCATGGAGACTATAATCTTAGGGTTAGAGCAGATATCAATGATGTAATTGCTGCTTTGGCAAGGGAAGCTGGACGGGTCGTCCTCCCAGATG GGACAACCTTTCCTTCAAAATCTCAGGTACTAAGGTTCAAAAAGGCACTAGGCGGTAGGCGGGCATTGGGTACTGCCTAA
AA sequence Show only first row Show all	>Lus10017819 pacid=23177703 polypeptide=Lus10017819 locus=Lus10017819.g ID=Lus10017819.BGIv1.0 annot-version=v1.0 MATDMQRLIVTSEEEEIDMDVKEEDNRGKHIDAQLMAGIDGGMLSDSCDSQFQYHQQLQEQVSTPGGENIGRRCRPVEEKERTKLRERHRRAITARILAG LRRHGDYNLRVRADINDVIAALAREAGRVVLPDGTTFPSKSQVLRFKKALGGRRALGTA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	0	1
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	2.0	0.8697
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	2.8	0.8595
AT2G21090			Pentatricopeptide repeat (PPR-...		Lus10019213 [exp]	4.9	0.8463
AT3G49990			unknown protein		Lus10015447 [exp]	5.7	0.8304
AT3G22470			Pentatricopeptide repeat (PPR)...		Lus10003426 [exp]	6.0	0.8005
AT2G30800		ATVT-1, HVT1	helicase in vascular tissue an...		Lus10001049 [exp]	6.3	0.7325
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	7.1	0.8197
AT3G01460		MBD9, ATMBD9	methyl-CPG-binding domain 9 (....		Lus10030624 [exp]	7.7	0.7865
AT3G14090		ATEXO70D3	exocyst subunit exo70 family p...		Lus10001113 [exp]	8.3	0.7541
AT5G02250		ATMTRNASEII, RN...	ribonucleotide reductase 1, EM...		Lus10010842 [exp]	11.0	0.8036

Compare expression of checked genes

Lus10017819 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.