Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33270 119 / 7e-33 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 117 / 4e-32 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT5G26900 90 / 3e-22 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27080 89 / 6e-22 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 67 / 4e-14 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034687 [exp] 227 / 3e-74 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 185 / 5e-58 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 182 / 7e-57 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 169 / 5e-50 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 168 / 1e-49 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 85 / 2e-20 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10038264 [exp] 46 / 7e-07 AT4G33270 240 / 4e-78 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G048900 [exp] 134 / 2e-38 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G118400 [exp] 133 / 5e-38 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 130 / 4e-37 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 97 / 1e-24 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 42 / 2e-05 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017847 pacid=23148818 polypeptide=Lus10017847 locus=Lus10017847.g ID=Lus10017847.BGIv1.0 annot-version=v1.0 ATGGCGAGAAGTTCTTCCAAGGATAACTTGGATCGCTTTATCACGAATCGGTCGGCCATGGATATGGATTACGCCCATTGGACGGCGACAGAAGGTTGGA AAGAGCCGGAGAATCCAGTCCCATGCTCTCCTTCAAGCGAGGCGTACAAGAGACTGTTGGCAGAGGCTATGGGCTTGAATCGCACGAGGATTTTGGCGTT CAAGAACAAGCCTCGTTCTACTGCTCCTGTTGAGTTGATTCCGCATCAGCATACTTGTTCAGATTCTTCGCTTCCTCACCGGGGGAAACCAAGCAAGCCA CTGAGACACATTCCTCAGACTTCAGAGAGGACATTGAAAACTCCTGACTAG
AA sequence Show only first row Show all	>Lus10017847 pacid=23148818 polypeptide=Lus10017847 locus=Lus10017847.g ID=Lus10017847.BGIv1.0 annot-version=v1.0 MARSSSKDNLDRFITNRSAMDMDYAHWTATEGWKEPENPVPCSPSSEAYKRLLAEAMGLNRTRILAFKNKPRSTAPVELIPHQHTCSDSSLPHRGKPSKP LRHIPQTSERTLKTPD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10017847 [exp]	0	1
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10017848 [exp]	1.0	0.9346
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Lus10033255 [exp]	6.5	0.7859
AT2G44260			Plant protein of unknown funct...		Lus10017582 [exp]	8.9	0.7921
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10017925 [exp]	10.6	0.7733
AT5G18590			Galactose oxidase/kelch repeat...		Lus10043420 [exp]	13.5	0.7437
AT1G68800	TCP	TCP12, BRC2, TC...	BRANCHED 2, TCP domain protein...		Lus10035055 [exp]	17.3	0.7704
AT4G00020		BRCA2(IV), BRCA...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10017785 [exp]	19.4	0.7584
AT4G19130			Replication factor-A protein 1...		Lus10003955 [exp]	21.9	0.7327
AT1G19780		ATCNGC8	cyclic nucleotide gated channe...		Lus10041662 [exp]	23.2	0.7234
AT5G14990			unknown protein		Lus10036529 [exp]	29.8	0.7607

Compare expression of checked genes

Lus10017847 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.