Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33260 192 / 1e-59 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT4G33270 192 / 2e-59 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT5G27570 183 / 2e-56 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G26900 180 / 5e-55 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G27080 179 / 2e-54 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G27945 178 / 3e-54 Transducin/WD40 repeat-like superfamily protein (.1) AT5G13840 134 / 4e-37 FZR3 FIZZY-related 3 (.1.2) AT4G22910 125 / 6e-34 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT4G11920 117 / 8e-31 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT5G54200 0 / 1 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034687 [exp] 233 / 2e-75 AT4G33270 620 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042765 [exp] 214 / 2e-68 AT4G33270 542 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10042748 [exp] 214 / 8e-65 AT4G33270 592 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 198 / 6e-62 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 197 / 3e-61 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 199 / 2e-59 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037595 [exp] 176 / 6e-56 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10025838 [exp] 145 / 2e-43 AT4G33270 295 / 3e-99 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10011833 [exp] 125 / 2e-35 AT4G33270 255 / 4e-83 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G118400 [exp] 196 / 5e-61 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 193 / 8e-60 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 192 / 3e-59 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 184 / 1e-56 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.008G057500 [exp] 125 / 9e-34 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.010G202100 [exp] 125 / 1e-33 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.001G112700 [exp] 120 / 4e-32 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.015G110300 [exp] 119 / 6e-32 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.003G119500 [exp] 116 / 1e-30 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.013G116900 [exp] 40 / 0.0005 AT1G71840 473 / 6e-167 transducin family protein / WD-40 repeat family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10017848 pacid=23148836 polypeptide=Lus10017848 locus=Lus10017848.g ID=Lus10017848.BGIv1.0 annot-version=v1.0 ATGGATTGGAACAACCACATCCTGACCACTGGAGGAATGGATGGAAAGATCTTAAACACCAATGTCAGGATCAGGGAACACGTCGTAACAAAATTTTGGG GCATGAATGTCAGGATCAGGGAACACGTCAGAACAAAATTTTGGGGCCACATGCATGAAGTCTGCGGACTGAAATGGTCGGATTTGGGTCAGCAATTAGC AAGCGGAGGCAACGACACTCTCGTCCACATCTGGGACATATCCATGGCTGCTTCTTCTTCTTCTTCCACCCCCCGGAGGACTCGGAACTTGCTCGCTACA GGAGGTGGCACAGAAGACAGGACGGTCAAGTTCTGGAACACCCACACGGGTGCTTGCTTGAACTCAGTGGACACGGGCTCTCAGGTCTGTGCATTGCAGT GGAACTCTAACGAGAGGGAACACTTAAGCTCTCATGGTTTGTCCGGGAATCAGCTGACCTTGTGGAAGTATCCATCCATGAAGAAGATTGCAGAGCTTAG GCCACACCTCCAGGGTCCTGTTCATGGCTCAGAGTCCGGATGGATGCTCCGTGGCTACTGCAGCAGGGGAGAATCGAATTGA
AA sequence Show only first row Show all	>Lus10017848 pacid=23148836 polypeptide=Lus10017848 locus=Lus10017848.g ID=Lus10017848.BGIv1.0 annot-version=v1.0 MDWNNHILTTGGMDGKILNTNVRIREHVVTKFWGMNVRIREHVRTKFWGHMHEVCGLKWSDLGQQLASGGNDTLVHIWDISMAASSSSSTPRRTRNLLAT GGGTEDRTVKFWNTHTGACLNSVDTGSQVCALQWNSNEREHLSSHGLSGNQLTLWKYPSMKKIAELRPHLQGPVHGSESGWMLRGYCSRGESN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10017848 [exp]	0	1
AT4G33270		AtCDC20.1, CDC2...	cell division cycle 20.1, Tran...		Lus10017847 [exp]	1.0	0.9346
AT1G19780		ATCNGC8	cyclic nucleotide gated channe...		Lus10041662 [exp]	4.2	0.7851
AT5G51980	C3HZnF		Transducin/WD40 repeat-like su...		Lus10033255 [exp]	5.5	0.8054
AT2G04940			scramblase-related (.1)		Lus10004532 [exp]	5.7	0.8155
AT5G18590			Galactose oxidase/kelch repeat...		Lus10043420 [exp]	6.5	0.7696
AT4G19130			Replication factor-A protein 1...		Lus10003955 [exp]	8.9	0.7688
AT2G44260			Plant protein of unknown funct...		Lus10017582 [exp]	11.5	0.8018
AT1G04900			Protein of unknown function (D...		Lus10007135 [exp]	17.9	0.7313
AT2G44590		ADL1D	DYNAMIN-like 1D (.1.2.3)		Lus10030928 [exp]	21.3	0.7884
AT5G48720		XRI1, XRI	x-ray induced transcript 1 (.1...		Lus10038181 [exp]	23.2	0.7409

Compare expression of checked genes

Lus10017848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.