Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34520 131 / 1e-40 RPS14 mitochondrial ribosomal protein S14 (.1) ATCG00330 50 / 3e-09 ATCG00330.1, RPS14 chloroplast ribosomal protein S14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034657 [exp] 206 / 6e-71 AT2G34520 129 / 1e-39 mitochondrial ribosomal protein S14 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G424950 [exp] 156 / 3e-51 AT2G34520 134 / 1e-41 mitochondrial ribosomal protein S14 (.1) Potri.013G142336 [exp] 49 / 7e-09 ATCG00330 164 / 2e-54 chloroplast ribosomal protein S14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00253 [flax] [poplar] Ribosomal_S14 Ribosomal protein S14p/S29e
Representative CDS sequence Show only first row Show all	>Lus10017877 pacid=23148813 polypeptide=Lus10017877 locus=Lus10017877.g ID=Lus10017877.BGIv1.0 annot-version=v1.0 ATGTGGGAGGACGAGCCAAAGTGCATAAAAGATAACAATCGTAGATTGTTAGCAGAAAAATTTGAGCTGAAGAGGAATCTCTACAAAGCCTTTATTAGAG ATCCTCAGCTTCCTGCTGAAATGCGCGAGAAACTTACTGCTAAACTGTCGAGGTTGCCCAGGAATAGCTCCTTCACACGGATTAGAAACCGGTGTGTGTT CTCCGGACGCCCTCGCGGTGTTTATGAGCTCTTCAGAATGTCTCGTATTGTTTTCCGCACATTAGCAAATCAAGGAAAGCTGAATGGCGTCAAGAAGGCT TCGTGGTGA
AA sequence Show only first row Show all	>Lus10017877 pacid=23148813 polypeptide=Lus10017877 locus=Lus10017877.g ID=Lus10017877.BGIv1.0 annot-version=v1.0 MWEDEPKCIKDNNRRLLAEKFELKRNLYKAFIRDPQLPAEMREKLTAKLSRLPRNSSFTRIRNRCVFSGRPRGVYELFRMSRIVFRTLANQGKLNGVKKA SW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34520		RPS14	mitochondrial ribosomal protei...		Lus10017877 [exp]	0	1
AT1G07170			PHF5-like protein (.1.2.3)		Lus10018253 [exp]	1.4	0.8693
AT3G18760			Translation elongation factor...		Lus10038301 [exp]	6.8	0.8603
AT3G06610			DNA-binding enhancer protein-r...		Lus10037773 [exp]	8.7	0.8425
AT5G59460			scarecrow-like transcription f...		Lus10004969 [exp]	10.7	0.8547
AT4G08460			Protein of unknown function (D...		Lus10009772 [exp]	11.0	0.8292
AT1G77350			unknown protein		Lus10018864 [exp]	11.2	0.8036
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10019500 [exp]	12.0	0.7937
AT1G20430			unknown protein		Lus10034561 [exp]	13.5	0.8172
AT4G12230			alpha/beta-Hydrolases superfam...		Lus10032207 [exp]	17.4	0.8440
AT1G77750			Ribosomal protein S13/S18 fami...		Lus10035785 [exp]	17.7	0.8310

Compare expression of checked genes

Lus10017877 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.