Lus10017879 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08100 152 / 9e-46 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT3G16150 108 / 7e-29 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT4G00590 42 / 5e-05 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034668 174 / 2e-54 AT5G08100 489 / 6e-176 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10034655 172 / 9e-54 AT5G08100 507 / 0.0 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10024795 111 / 5e-30 AT3G16150 536 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Lus10040935 45 / 9e-06 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009826 43 / 4e-05 AT4G00590 446 / 2e-156 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G063400 159 / 1e-48 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G022900 112 / 1e-30 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.002G122900 110 / 9e-30 AT3G16150 540 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.014G080600 45 / 9e-06 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Lus10017879 pacid=23148861 polypeptide=Lus10017879 locus=Lus10017879.g ID=Lus10017879.BGIv1.0 annot-version=v1.0
ATGGGTTGGGCAATCGCTCTCCACGGCGGCGCCGGCGACATACCACGCTCTCTTCTGCCCGACCGCTGTCTCCCCCGCGAAGCCGCTCCCTCCAGCTCGG
TGTCTCCGCTCTTCAGTCCAACTCCCACCCTCTTGACGTCGTCGAGCTCGTCTTGGTTGTTCTCTCGTTTTGTCCTTAACTTTGGTGGTCTATGTACTGT
TGGTGAATTGGAGAACCACCCACAGTTTAATGCTGGTAAGGGATCTGTGTTAACCGCTGTTGGGACAGTGGAGATGGAAGCCATCATGGACGGCAAAACA
AAGAAATGTGGAGCAGTTTCTGGACTTACCACTGTTGTCAACGCTATCTCACTTGCACGCCTCGTCATGGAAAAGACTCCTCACATCTATCCAGGATTCG
AAGGAGCTGAAGCTTTTGCAAGGGAACAAGTCAGTTTATTCTTAGCTCCCTTTCTTCTGTGGAGCTCTGAAGTCTGA
AA sequence
>Lus10017879 pacid=23148861 polypeptide=Lus10017879 locus=Lus10017879.g ID=Lus10017879.BGIv1.0 annot-version=v1.0
MGWAIALHGGAGDIPRSLLPDRCLPREAAPSSSVSPLFSPTPTLLTSSSSSWLFSRFVLNFGGLCTVGELENHPQFNAGKGSVLTAVGTVEMEAIMDGKT
KKCGAVSGLTTVVNAISLARLVMEKTPHIYPGFEGAEAFAREQVSLFLAPFLLWSSEV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08100 ASPGA1 asparaginase A1, N-terminal nu... Lus10017879 0 1
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10024685 1.7 0.9612
AT1G16310 Cation efflux family protein (... Lus10001768 2.2 0.9680
AT3G61660 unknown protein Lus10033949 2.2 0.9542
AT1G14180 RING/U-box superfamily protein... Lus10036764 3.7 0.9615
AT3G58360 TRAF-like family protein (.1) Lus10012948 4.2 0.9453
Lus10010608 7.3 0.9341
AT1G60790 TBL2 TRICHOME BIREFRINGENCE-LIKE 2,... Lus10030590 8.7 0.9376
AT1G70840 MLP31 MLP-like protein 31 (.1) Lus10020497 9.4 0.9573
AT2G47460 MYB PFG1, ATMYB12 PRODUCTION OF FLAVONOL GLYCOSI... Lus10001458 9.6 0.9392
AT1G09440 Protein kinase superfamily pro... Lus10030863 10.2 0.9412

Lus10017879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.