Lus10017894 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06450 47 / 9e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 44 / 1e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 43 / 2e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G61470 42 / 5e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 40 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 40 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
AT1G80780 40 / 0.0002 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017905 255 / 2e-86 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 245 / 2e-82 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000561 228 / 1e-75 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10001651 228 / 1e-74 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 202 / 1e-65 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038112 197 / 2e-65 AT1G06450 52 / 4e-08 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 120 / 1e-33 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 110 / 6e-30 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 74 / 4e-16 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 48 / 4e-07 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 44 / 8e-06 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 42 / 6e-05 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.001G046700 40 / 0.0002 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 39 / 0.0006 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 38 / 0.001 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10017894 pacid=23148840 polypeptide=Lus10017894 locus=Lus10017894.g ID=Lus10017894.BGIv1.0 annot-version=v1.0
ATGGCTAAGTTCTATGAAGACACATTGAGTGAAATTGGGTTGCAGAAGTTAGCGGATGCTTTGGGGGTTAAGAGAAGAGGGGAAGCTCATACTGCCGCCT
CTGATAGTTTCTTGACGGCGCTGGTTTACTTTGAGTTGAAGAAGAAACTGATGCTGTTGGGTGTTGATGAAGAGTCTTACGTTGATTACGTCTATGGAAT
CAGCACCAAAATCTCCAGGAAGCAGAAAGAGCCCCTCTTTCTACCAACTGCTCGACCAGCAGGTCCTCCTGTGTATCATCATCATCCTTATCATCCTCAT
CTTTATCAGAGTAAGGTGCTGTATCCCATTCCATATCAGCAGAGAGTAGTACCCTTGCCTCCAAATGTGATGATGGGTCGTCGTTGGGTTGATTGCTCAT
TAGCTCCAACAGTATTAGTTCCTTCTTTCATCTACTGA
AA sequence
>Lus10017894 pacid=23148840 polypeptide=Lus10017894 locus=Lus10017894.g ID=Lus10017894.BGIv1.0 annot-version=v1.0
MAKFYEDTLSEIGLQKLADALGVKRRGEAHTAASDSFLTALVYFELKKKLMLLGVDEESYVDYVYGISTKISRKQKEPLFLPTARPAGPPVYHHHPYHPH
LYQSKVLYPIPYQQRVVPLPPNVMMGRRWVDCSLAPTVLVPSFIY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G06450 Polynucleotidyl transferase, r... Lus10017894 0 1
AT5G50130 NAD(P)-binding Rossmann-fold s... Lus10018092 4.1 0.7884
AT2G38560 RDO2, TFIIS REDUCED DORMANCY 2, transcript... Lus10022735 6.5 0.7803
AT1G50670 OTU-like cysteine protease fam... Lus10021522 9.6 0.7798
AT2G46220 Uncharacterized conserved prot... Lus10010135 16.6 0.7750
AT5G52880 F-box family protein (.1) Lus10027547 19.6 0.7496
Lus10025227 23.4 0.7671
AT1G43850 SEU SEUSS transcriptional co-regul... Lus10029753 24.3 0.7405
AT1G06450 Polynucleotidyl transferase, r... Lus10017905 25.3 0.7070
AT1G22100 Inositol-pentakisphosphate 2-k... Lus10024274 28.6 0.7028
AT1G25220 WEI7, TRP4, ASB... WEAK ETHYLENE INSENSITIVE7, TR... Lus10030761 34.9 0.7292

Lus10017894 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.