Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G22250 97 / 1e-24 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G06450 98 / 2e-24 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G44240 94 / 5e-24 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT2G32070 94 / 2e-23 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G80780 93 / 3e-23 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) AT3G44260 92 / 7e-23 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G15920 91 / 3e-22 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2) AT1G61470 89 / 1e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G27820 89 / 2e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G10960 88 / 3e-21 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035077 [exp] 268 / 1e-90 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10008043 [exp] 257 / 1e-86 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017905 [exp] 239 / 3e-79 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10001651 [exp] 236 / 3e-77 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10038113 [exp] 213 / 2e-70 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10000327 [exp] 209 / 7e-68 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10035078 [exp] 205 / 2e-66 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10000561 [exp] 184 / 5e-58 AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10007771 [exp] 131 / 2e-37 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G038700 [exp] 116 / 8e-32 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.016G073000 [exp] 98 / 5e-25 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.001G046700 [exp] 97 / 9e-25 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.003G181100 [exp] 95 / 5e-24 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) Potri.004G200400 [exp] 92 / 9e-23 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G205600 [exp] 92 / 2e-22 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.009G161500 [exp] 91 / 2e-22 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.018G020900 [exp] 88 / 2e-21 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G187200 [exp] 87 / 6e-21 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G262500 [exp] 87 / 9e-21 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [flax] [poplar] RNase_H PF04857 [flax] [poplar] CAF1 CAF1 family ribonuclease
Representative CDS sequence Show only first row Show all	>Lus10017895 pacid=23148811 polypeptide=Lus10017895 locus=Lus10017895.g ID=Lus10017895.BGIv1.0 annot-version=v1.0 ATGGCTTCTTTTCATGATGTGAGGGAAGTCTGGAATCATAACTTCGACCACGAACTGTACGCCATGGAAGTCTGTTTGAGAAGCTACCCAGTAGTGTCCG TGGACACAGAGTTCCCAGGTTGCCTTCGTCCGACATCGAGGTACGCTTCCGAGGAACTCCGATTTCAGAACTTGAAGTACAACGTCGGCGCAACCTCTCT GATTCAATTAGGGCTCACTCTCTGCAATTCCGACGGCACCGTCGGCGGCGTATGGCAATTCAACTTCCACTTCGACCTAGATCGCGACCTCCACTCCAAA GATTCCACCGATTTCTTGGCCCTCCACGGAATCGATTTCCAGAAATTGAAAACCCACGGTGTCGACCGGGTCAGATTCGGCGCCATGTTCGGAGCGGTGA TTCGGAGAAGGCGGAGTGCGATTACTAAGGTGGAGTGCGATTATGTGGATCACTTTCCACGGAGTTTACGATTACGCCTATCTCGTGAAGGCGGTGACTT CCCGTCCGGTTGCGGAATCATCGGCGGAATTCGTTAA
AA sequence Show only first row Show all	>Lus10017895 pacid=23148811 polypeptide=Lus10017895 locus=Lus10017895.g ID=Lus10017895.BGIv1.0 annot-version=v1.0 MASFHDVREVWNHNFDHELYAMEVCLRSYPVVSVDTEFPGCLRPTSRYASEELRFQNLKYNVGATSLIQLGLTLCNSDGTVGGVWQFNFHFDLDRDLHSK DSTDFLALHGIDFQKLKTHGVDRVRFGAMFGAVIRRRRSAITKVECDYVDHFPRSLRLRLSREGGDFPSGCGIIGGIR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G06450			Polynucleotidyl transferase, r...		Lus10017895 [exp]	0	1
AT3G01910		AT-SO, ATSO, SO...	sulfite oxidase (.1.2.3)		Lus10012532 [exp]	2.8	0.8126
AT1G71080			RNA polymerase II transcriptio...		Lus10004071 [exp]	5.7	0.7320
AT1G53025			Ubiquitin-conjugating enzyme f...		Lus10028151 [exp]	6.2	0.7732
					Lus10033943 [exp]	10.2	0.7615
AT2G32010		CVL1	CVP2 like 1 (.1.2)		Lus10006597 [exp]	12.0	0.7570
AT1G29350			Kinase-related protein of unkn...		Lus10000188 [exp]	17.5	0.7265
AT3G52210			S-adenosyl-L-methionine-depend...		Lus10037917 [exp]	19.7	0.7418
AT1G67370		ASY1, ATASY1	ASYNAPTIC 1, DNA-binding HORMA...		Lus10040113 [exp]	29.2	0.7468
AT1G06450			Polynucleotidyl transferase, r...		Lus10017905 [exp]	31.4	0.6863
AT1G08230		ATGAT1	L-GAMMA-AMINOBUTYRIC ACID TRAN...		Lus10037913 [exp]	31.5	0.6597

Compare expression of checked genes

Lus10017895 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.