Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25610 125 / 5e-35 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G13210 120 / 4e-33 ACA.L autoinhibited Ca2+/ATPase II, autoinhibited Ca2+/ATPase II (.1) AT1G68710 119 / 6e-33 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G26130 83 / 5e-20 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1.2) AT1G17500 68 / 1e-14 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G72700 65 / 2e-13 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT3G13900 62 / 8e-13 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT3G27870 62 / 1e-12 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) AT1G54280 58 / 3e-11 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035069 [exp] 172 / 2e-51 AT3G25610 1783 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10035068 [exp] 147 / 1e-42 AT1G68710 1677 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10034404 [exp] 139 / 8e-40 AT3G25610 969 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10019152 [exp] 138 / 2e-39 AT3G25610 1871 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10006017 [exp] 66 / 7e-14 AT1G17500 1851 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10008473 [exp] 66 / 8e-14 AT1G17500 1914 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10037622 [exp] 65 / 1e-13 AT1G17500 1895 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10006881 [exp] 65 / 1e-13 AT1G17500 1907 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Lus10008777 [exp] 56 / 2e-11 AT3G27870 161 / 5e-47 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G058000 [exp] 124 / 2e-34 AT1G68710 1764 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.008G111200 [exp] 91 / 9e-23 AT1G68710 1767 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.010G132700 [exp] 86 / 4e-21 AT1G68710 1753 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.003G043300 [exp] 64 / 2e-13 AT1G17500 1891 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.001G197500 [exp] 57 / 1e-10 AT1G17500 1902 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.001G349100 [exp] 54 / 1e-09 AT3G27870 1687 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1) Potri.001G081200 [exp] 52 / 6e-09 AT1G17500 1461 / 0.0 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10017901 pacid=23148833 polypeptide=Lus10017901 locus=Lus10017901.g ID=Lus10017901.BGIv1.0 annot-version=v1.0 ATGTCACCTAGATTTGCAGGGAATGCCTACATGATCTTCGTTGAAGTACCGGCCCCAACGCCTTCATTCTGGATCATCATGCTATTCGCTGTGATCTCAA CGTTGATACCATACTTTTGCTTTTCAACAGTGCAAATGAAGTTCTTCCCGATGTATCATCAGATGATACAGTGGATAAGGCATGAAGGGCGGTCAGAGGA TCTCGAGTTTTGCTACACGGTTCGACAGAGGTCGATTAGGCCAGCCGCGGTTGGTTTAACAGCTCGAGTAGCTGCAAAAATTAAGTAG
AA sequence Show only first row Show all	>Lus10017901 pacid=23148833 polypeptide=Lus10017901 locus=Lus10017901.g ID=Lus10017901.BGIv1.0 annot-version=v1.0 MSPRFAGNAYMIFVEVPAPTPSFWIIMLFAVISTLIPYFCFSTVQMKFFPMYHQMIQWIRHEGRSEDLEFCYTVRQRSIRPAAVGLTARVAAKIK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25610			ATPase E1-E2 type family prote...		Lus10017901 [exp]	0	1
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10020085 [exp]	7.3	0.7219
AT5G03100			F-box/RNI-like superfamily pro...		Lus10029952 [exp]	10.8	0.6207
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10020511 [exp]	14.8	0.5923
					Lus10021381 [exp]	15.1	0.6028
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10021638 [exp]	20.8	0.5753
AT3G22400		ATLOX5, LOX5	Arabidopsis thaliana lipoxygen...		Lus10008041 [exp]	21.9	0.5875
					Lus10015636 [exp]	27.1	0.5727
AT1G47710			Serine protease inhibitor (SER...		Lus10040926 [exp]	30.2	0.5711
AT3G20190			Leucine-rich repeat protein ki...		Lus10034795 [exp]	37.7	0.5596
AT5G01150			Protein of unknown function (D...		Lus10002340 [exp]	38.6	0.5519

Compare expression of checked genes

Lus10017901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.