Lus10017902 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53500 57 / 4e-10 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G42010 45 / 6e-06 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G54200 45 / 8e-06 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G64610 44 / 1e-05 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT5G24320 42 / 8e-05 Transducin/WD40 repeat-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011313 262 / 3e-88 AT5G53500 129 / 1e-32 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10012846 198 / 4e-65 AT5G53500 74 / 4e-15 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10000387 185 / 1e-58 AT5G02430 53 / 1e-14 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003206 175 / 3e-52 AT1G64610 427 / 1e-141 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017312 172 / 9e-51 AT1G64610 439 / 4e-146 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10023033 151 / 4e-43 AT5G24320 508 / 3e-171 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10032436 149 / 4e-42 AT5G24320 516 / 1e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10007783 52 / 2e-08 AT5G24320 246 / 3e-73 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10022377 52 / 3e-08 AT5G24320 530 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G086600 108 / 6e-28 AT5G24320 514 / 1e-173 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.003G144400 107 / 2e-27 AT5G24320 516 / 4e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.015G009700 66 / 5e-13 AT5G24320 621 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.012G018200 59 / 1e-10 AT5G24320 606 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G174100 58 / 2e-10 AT5G53500 523 / 1e-177 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G057600 55 / 3e-09 AT5G24320 384 / 3e-124 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.007G110500 55 / 3e-09 AT5G24320 411 / 1e-134 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.006G084600 39 / 0.0006 AT2G37670 920 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G403400 39 / 0.0006 AT3G15470 828 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10017902 pacid=23148866 polypeptide=Lus10017902 locus=Lus10017902.g ID=Lus10017902.BGIv1.0 annot-version=v1.0
ATGTTTTGGTGGGGAATTATAGTTTTTTTAAAAAGGGACTTGCTTTCTTTTGCGCTTTTCAGTGTCGCACCTCCGAACCAGATGCACTCCACTTTTACTT
CAGACGGGAAGAGTTGTGTCTCGACGAGCGACGACTGGAATGCCTACATACGGACCTACGACAAACAGGAGAAGCCGTCCTCTCGAGCTAAGCTTATCTG
CTCATACAAGAGCTTCATTTCCCCTAATGCATCGGTCGCAATACCTTGGCGTGGGATCGAAACTGAGCCAGCTGGCACAATCTCATCCAGACGACCCCAA
TCTGACCATAACCATCACAAGAGCATCATATCCTCGCCGTATTGTTTCAACATCATTCAAGGGTTTTTGCTAGATTCTCTATCCAGGGGAGCTGCAACTT
GGCTAGGGGGGAATCTTCCTCATTCGAAACCGGTACTCAAATCAGAGTTGAAGTTCAATCCTCAAATGTAG
AA sequence
>Lus10017902 pacid=23148866 polypeptide=Lus10017902 locus=Lus10017902.g ID=Lus10017902.BGIv1.0 annot-version=v1.0
MFWWGIIVFLKRDLLSFALFSVAPPNQMHSTFTSDGKSCVSTSDDWNAYIRTYDKQEKPSSRAKLICSYKSFISPNASVAIPWRGIETEPAGTISSRRPQ
SDHNHHKSIISSPYCFNIIQGFLLDSLSRGAATWLGGNLPHSKPVLKSELKFNPQM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G53500 Transducin/WD40 repeat-like su... Lus10017902 0 1
AT3G17590 CHE1, BSH BUSHY GROWTH, transcription re... Lus10013697 4.4 0.7600
AT1G63260 TET10 tetraspanin10 (.1.2.3) Lus10002230 30.9 0.7201
AT4G02980 ABP1 endoplasmic reticulum auxin bi... Lus10027985 31.8 0.7200
Lus10039628 39.6 0.7114
AT3G50780 unknown protein Lus10016789 41.3 0.6924
AT4G25440 C3HZnF ZFWD1 zinc finger WD40 repeat protei... Lus10034704 45.5 0.6116
AT5G49690 UDP-Glycosyltransferase superf... Lus10002351 46.6 0.7083
AT4G30850 HHP2 heptahelical transmembrane pr... Lus10036605 49.3 0.6695
AT4G35980 unknown protein Lus10009388 51.4 0.7060
AT2G40435 unknown protein Lus10025257 52.7 0.6985

Lus10017902 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.